Artefacts

'I killed the GHB and all I got was this lousy T-shirt!'

Weight 1.0 lb / Value 1 / Armour 1

QUESTITEM

'Nimthanc'

Depth 3 / Weight 1.2 lb / Value 11,000 / Damage 2d5

A frosty dagger finely balanced for deadly throws.

Activates: Bolt Cold (every 12 turns)

BRAND_COLDRES_COLDSHOW_MODSTHROWINGXTRA_H_RESSPEED

'Narthanc'

Depth 4 / Weight 1.2 lb / Value 12,000 / Damage 2d5

A fiery dagger finely balanced for deadly throws.

Activates: Bolt Fire (every 12 turns)

BRAND_FIRERES_FIRESHOW_MODSLITETHROWINGXTRA_H_RESSPEED

'Dethanc'

Depth 5 / Weight 1.2 lb / Value 13,000 / Damage 2d5

A dagger covered in sparks and finely balanced for deadly throws.

Activates: Beam Elec (every 12 turns)

BRAND_ELECRES_ELECSHOW_MODSLITETHROWINGXTRA_H_RESSPEED

of David

Depth 5 / Weight 0.2 lb / Value 2,000 / Damage 7d3

KILL_GIANT

Dog Collar of Fang

Depth 5 / Weight 3.0 lb / Value 5,000

QUESTITEMHIDE_TYPEFULL_NAMERES_FEARSTR

Dog Collar of Wolf

Depth 5 / Weight 3.0 lb / Value 5,000

QUESTITEMHIDE_TYPEFULL_NAMEFREE_ACTCON

Dog Collar of Grip

Depth 5 / Weight 3.0 lb / Value 5,000

QUESTITEMHIDE_TYPEFULL_NAMESPEEDDEX

'Grimtooth'

Depth 7 / Weight 1.2 lb / Value 25,000 / Damage 1d5

DEXBLOWSBRAND_POISSHOW_MODSTHROWING

of Dr. Jones

Depth 8 / Weight 3.0 lb / Value 18,000 / Damage 1d7

Activates: Telekinesis (every 30 turns)

INTWISLEVITATIONSHOW_MODSSEE_INVIS

'Cammithrim'

Depth 10 / Weight 0.5 lb / Value 30,000 / Armour 1

These gloves glow so brightly as to light the way for their owner and castmagical bolts with great frequency.

Activates: Bolt Missile (every 2 turns)

FREE_ACTRES_LITESUST_CONLITE

'Lotharang'

Depth 10 / Weight 17.0 lb / Value 21,000 / Damage 2d9

A superbly crafted battle axe with spells to slay all creatures of earthand allow rapid recovery from their blows, renowned in legends of the Northas a token of the lasting friendship between dwarves and men. Lord Gwilimonce wielded it in battle, its twin blades singing in the night as heconquered the forest camp of the orcs of Morgul and single-handedlyrepelled their foul invasion.

Activates: Heal (every 4 turns)

STRDEXHIDE_TYPESLAY_TROLLSLAY_ORCSHOW_MODS

of Taikobo

Depth 10 / Weight 3.0 lb / Value 10,000

Activates: Fishing

INSTA_ART

of Samson

Depth 10 / Weight 5.0 lb / Value 40,000 / Damage 3d5

STRCONSEE_INVISSLAY_EVILSLAY_UNDEAD

of Maggot

Depth 10 / Weight 7.0 lb / Value 10,000 / Damage 2d4

This is farmer Maggot's sickle. He left it behind on hisfarm.

STRDEXRES_FIRERES_LITEVORPAL

of the Fell Rider

Depth 10 / Weight 1.5 lb / Value 10,000 / Armour 2

An old, timeworn leather cap, embroidered with the motto of Fell LiveryStable: 'FELL. The rider - it's you.'

WISDEC_CHRRES_FIRERES_LITESUST_INTHIDE_TYPE

of Njord

Depth 10 / Weight 3.0 lb / Value 10,000

The fishingpole of the god Njord. It is without an equal.

Activates: Fishing

QUESTITEM

of the Great Wizzard

Depth 10 / Weight 2.0 lb / Value 1,000 / Armour 1

Previously owned by a famous wizard.

DEC_STEALTHHIDE_TYPE

'Dunce Cap'

Depth 10 / Weight 0.5 lb / Armour 1

It generates special feelings.

DEC_INTDEC_WISDEC_SPELL_CAPHEAVY_CURSE

of Rilia

Depth 15 / Weight 1.2 lb / Value 35,000 / Damage 3d5

A large stiletto dagger that glistens with odorless poison, to which thewearer seems oddly tolerant.

Activates: Ball Pois (every 6 turns)

SLAY_ORCRES_POISRES_DISENSHOW_MODSBRAND_POISTHROWINGSPEED

'Forasgil'

Depth 15 / Weight 4.0 lb / Value 15,000 / Damage 1d8

A slender, tapered blade whose wielder strikes icy blows with deadlyaccuracy.

SLAY_ANIMALBRAND_COLDRES_COLDRES_LITELITESHOW_MODSSPEED

'Careth Asdriag'

Depth 15 / Weight 5.0 lb / Value 25,000 / Damage 1d9

An heirloom of the Lords of Rhun far to the east, and a name ofdismay to creatures natural and unnatural.

BLOWSSLAY_DRAGONSLAY_ANIMALSLAY_TROLLSLAY_GIANTSLAY_HUMANSLAY_ORCSHOW_MODSRIDING

of Hagen

Depth 15 / Weight 5.0 lb / Value 30,000 / Damage 1d8

STEALTHRES_DARKINFRASPEEDRIDINGBRAND_COLDSLAY_UNDEADRES_COLDSEE_INVISSHOW_MODSTHROWING

of Azaghal

Depth 15 / Weight 3.0 lb / Value 40,000 / Damage 2d6

At the Nirnaeth the Dwarves stayed the onslaught of Glaurung, andAzaghal their lord drove this short blade into the drake's belly beforehe was trampled underfoot. The black blood of the Father of Dragonsnow serves as a remembrance for all dragons that come near it.

KILL_DRAGONESP_DRAGONIM_FIREXTRA_RES_OR_POWER

'Hyousi-gi'

Depth 15 / Weight 1.5 lb / Value 808 / Damage 1d2

Activates: Aggravate

SEARCHSHOW_MODSHIDE_TYPE

of Bolshoi

Depth 15 / Weight 3.0 lb / Value 22,500 / Damage 2d8

Activates: Charm Animal (every 200 turns)

DEXCHRHIDE_TYPERIDINGKILL_ANIMALESP_ANIMALBRAND_FIRE

of Elmi the Murderer

Depth 15 / Weight 6.0 lb / Value 50,000 / Damage 3d6

This is a hatchet of Elmi who was a horrible murderer ofRaffnor.

DEXSTEALTHHIDE_TYPEBRAND_MANAKILL_HUMANVORPALSEE_INVIS

'Nogudil'

Depth 15 / Weight 12.0 lb / Value 26,000 / Damage 2d6

As you lift this great hammer, all your doubts are dispelled: it's time to get going and crush your enemies into a pulp.

SLAY_GOODSLAY_EVILIM_COLDRES_FEARFREE_ACTVULN_LITEDEC_INTDEC_WISAGGRAVATESPEED

of Tweutox

Depth 15 / Weight 5.0 lb / Value 30,000 / Damage 1d8

Tiotullo, the spear of Tweutox, carved from the wood of a Seepumis tree.It seems to pulsate with energy as you hold it.

SPEEDSTRRES_FEARDEC_STEALTHBRAND_CHAOSRIDINGHIDE_TYPE

of Murugan

Depth 15 / Weight 5.0 lb / Value 30,000 / Damage 4d8

The great spear of the warrior-philosopher-god Karthikeya, also known asMurugan. It was a present from his mother Parvati, and is imbued with theenergy of both.

Activates: Dispel Demon (every 90 turns)

SPEEDSTRWISRES_DARKRIDINGTHROWINGSEE_INVISSLAY_DEMONVORPALFREE_ACTRES_CHAOSRES_FEARSUST_STRSUST_WISSLOW_DIGESTESP_DEMONSHOW_MODSQUESTITEM

Bobble Hat of Barnaby

Depth 16 / Weight 0.8 lb / Value 10,000 / Armour 1

A camouflage bobble-hat knitted from wool, once worn by the great adventurerBarnaby.

Activates: Phase Door (every 5 turns)

INTDEXCHRSTEALTHFREE_ACTRES_COLDSEARCHFULL_NAME

of Thingol

Depth 20 / Weight 1.0 lb / Value 45,000 / Armour 1

A sable-hued cloak, with glowing elven-runes to restore magic showing calmand clear as moonlight on still water.

Activates: Recharge From Device (every 70 turns)

DEXCHRHIDE_TYPEXTRA_POWERFREE_ACTRES_ACIDRES_FIRERES_COLD

of Thorongil

Depth 20 / Weight 1.0 lb / Value 13,000 / Armour 1

A cloak of shimmering green and brown that grants sight beyond sight andshakes off holding magics, worn by Aragorn son of Arathorn in his youthas he adventured under the name of Thorongil.

FREE_ACTRES_ELECRES_FIRERES_COLDSEE_INVIS

'Colannon'

Depth 20 / Weight 1.0 lb / Value 15,000 / Armour 1

A crystal-blue cape of fine silk worn by a silent messenger ofthe forces of Law. Somehow, its wearer is always able to escapetrouble.

Activates: Teleport (every 45 turns)

STEALTHRES_ACID

'Orcrist'

Depth 20 / Weight 15.0 lb / Value 40,000 / Damage 2d6

This coldly gleaming blade is called simply "Biter", by orcs who came toknow its power all too well.

STEALTHSLAY_EVILBRAND_COLDKILL_ORCRES_COLDRES_DARKLITESLOW_DIGESTSHOW_MODSRIDINGXTRA_RES_OR_POWERESP_ORCESP_TROLLESP_GIANT

'Gondricam'

Depth 20 / Weight 11.0 lb / Value 28,000 / Damage 1d9

Famed sea-defender of Lebennin. A short, slightly curved chopping bladewith a perfect edge shining cleanly in the sun, an object of hate to themen of Umbar who met it in combat.

DEXSTEALTHHIDE_TYPERES_ACIDRES_ELECRES_FIRERES_COLDLEVITATIONSEE_INVISREGENSHOW_MODS

'Sting'

Depth 20 / Weight 7.5 lb / Value 100,000 / Damage 1d8

"I will give you a name, and I shall call you Sting." The perfect sizefor Bilbo, and stamped forever by the courage he found in Mirkwood, thissturdy little blade grants the wearer combat prowess and survivalabilities they did not know they had.

STRDEXCONBLOWSSLAY_EVILSLAY_UNDEADSLAY_ORCFREE_ACTRES_LITELITESEE_INVISSHOW_MODSXTRA_H_RESQUESTITEMESP_ORCESP_TROLLESP_GIANT

of Merlin

Depth 20 / Weight 8.0 lb / Value 35,000 / Damage 1d8

BLOWSSLAY_ANIMALSLOW_DIGESTREGENSHOW_MODSSEE_INVISRES_DISEN

'Osondir'

Depth 20 / Weight 19.0 lb / Value 22,000 / Damage 3d6

Lordly and tall did Osondir stand against the wrath of giants, andclear-eyed in barrows fell, wielding a halberd glowing ruby red.

CHRHIDE_TYPEBRAND_FIRESLAY_UNDEADSLAY_GIANTRES_FIRERES_SOUNDLEVITATIONSEE_INVISSHOW_MODSLITE

'Til-i-arc'

Depth 20 / Weight 16.0 lb / Value 32,000 / Damage 2d6

Within this long thrusting spear lie the spirits of frost giants and firedemons, who war forever, trapped by magely spells.

INTHIDE_TYPEBRAND_COLDBRAND_FIRESLAY_DEMONSLAY_TROLLSLAY_GIANTRES_FIRERES_COLDSUST_INTSLOW_DIGESTSHOW_MODSLITE

'Totila'

Depth 20 / Weight 15.0 lb / Value 55,000 / Damage 3d7

A flail whose head befuddles those who stare as you whirl it around, andbecomes a fiery comet as you bring it down.

Activates: Confuse Monsters (every 50 turns)

STEALTHSLAY_EVILBRAND_FIRERES_FIRERES_CONFSHOW_MODSLITERIDING

'Eriril'

Depth 20 / Weight 15.0 lb / Value 100,000 / Damage 1d10

The radiant golden staff of an Istar of legend, this wizard's companiongrants keen sight and the knowledge of many hidden things.

Activates: Identify (every 10 turns)

INTWISHIDE_TYPESPELL_CAPSLAY_EVILRES_LITELITESEE_INVISSHOW_MODS

'Turmil'

Depth 20 / Weight 12.0 lb / Value 30,000 / Damage 2d6

Wielded by the High Priest of Meneltarma, this great mace gleams coldly asthough moonlit, and it can strike as mighty a blow spiritually asphysically.

Activates: Drain Life (every 70 turns)

WISINFRAHIDE_TYPEBLESSEDBRAND_COLDSLAY_ORCRES_COLDRES_LITELITEREGENSHOW_MODSXTRA_H_RES

of Giles

Depth 20 / Weight 20.0 lb / Value 30,000 / Damage 1d4 / Armour 12

The sturdy ring mail of Giles of Ham, who was turned from an unassumingfarmer to a great lord and hero by the might of his artifacts.

DEC_STEALTHRES_FIRERES_CHAOSRES_NEXUSRES_COLDHIDE_TYPE

'Matoi'

Depth 20 / Weight 10.0 lb / Value 808 / Damage 1d8

Activates: Heroism (every 45 turns)

STRCHRRES_FIRE

'Littlethorn'

Depth 20 / Weight 3.0 lb / Value 22,500 / Damage 1d6

INTCHRREGENSLAY_EVILRES_NEXUSFREE_ACTSEE_INVISSHOW_MODS

'Narsil'

Depth 20 / Weight 13.0 lb / Value 20,000 / Damage 4d2

A blade of Elendil that was broken by his fall as the battled Sauron upon the steps of Barad-Dur.

STRBLOWSHIDE_TYPESLAY_ORCSLAY_TROLLRES_FIRE

of Kamui the Escapee

Depth 20 / Weight 10.0 lb / Value 60,000 / Damage 2d10

Activates: Teleport (every 25 turns)

DEXSTEALTHSEARCHRES_FIREBRAND_POISSEE_INVISSHOW_MODSWARNING

'Dasai'

Depth 20 / Weight 11.0 lb / Armour 8

AGGRAVATESUST_CHRDEC_CHR

'Sumo Wrestler's Loincloth'

Depth 20 / Weight 6.0 lb / Value 50,000 / Armour 4

Activates: Dispel Evil Hero (every 150 turns)

STRCONSUST_STRSUST_CONFREE_ACT

'Tetsu-geta of Flame'

Depth 20 / Weight 15.0 lb / Value 40,000 / Armour 6

DEC_INTDEC_WISDEC_CHRDEC_STEALTHDEC_SPEEDRES_FIRESUST_STRSUST_CONAURA_FIREREGENRES_FEAR

of Robin Hood

Depth 20 / Weight 3.0 lb / Value 50,000 / Damage x3.25

This is of Robin Hood who live in the deep forest.

DEXCHRSTEALTHHIDE_TYPESHOW_MODSXTRA_H_RES

of Sam

Depth 20 / Weight 1.5 lb / Value 15,000 / Armour 2

Sam was brave and trustworthy companion of Frodo.With this cap, you feel able to face the dangersahead with a steady hand and a noble heart.

DEC_STRDEXHIDE_TYPESPEED

of Merry

Depth 20 / Weight 1.0 lb / Value 15,000 / Armour 1

Merry was the most perceptive and intelligent of hobbits.

DEC_STRDEXSTEALTHSPEEDRES_CONFSEARCHHIDE_TYPE

of Pippin

Depth 20 / Weight 0.5 lb / Value 15,000 / Armour 1

'Fool of a Took' ... Ah, but Peregrin was brave if not wise.

DEC_STRDEXHIDE_TYPESHOW_MODSSPEED

'Curiosity'

Depth 20 / Weight 8.0 lb / Value 40,000 / Damage 2d8

Very sharp, and ideal for cutting stray felines open for examination.

INTSUST_INTVORPALKILL_ANIMAL

of Manychin

Depth 20 / Weight 7.0 lb / Value 25,000 / Damage 3d4

The lost sickle of the legendary hero Manychin, who renounced his comfortable life as a prince to lead oppressed serfs in revolt against the nobility.

Activates: Charm Monster (every 25 turns)

STRDEC_STEALTHSLAY_HUMANSLAY_UNDEADESP_HUMANESP_UNDEADRES_FEARFREE_ACTVORPAL

of the Vagabond

Depth 22 / Weight 15.0 lb / Value 35,000 / Damage 2d7

The lonely traveller's one true friend.

CONSUST_CONRES_FEARREGENHOLD_LIFESLOW_DIGESTHIDE_TYPEBLESSED

'Hithlomir'

Depth 25 / Weight 8.0 lb / Value 45,000 / Armour 4

Familiar with the secret ways hidden in darkness, this leather cuirass istruly more than it appears.

STEALTHRES_ACIDRES_ELECRES_FIRERES_DARKXTRA_H_RES

of Thengel

Depth 25 / Weight 2.0 lb / Value 12,000 / Armour 3

A ridged helmet made of steel, and embossed with scenes of valor in fine-engraved silver. It grants the wearer nobility, clearness of thought andunderstanding.

WISCHRHIDE_TYPESPELL_CAP

'Holhenneth'

Depth 25 / Weight 7.5 lb / Value 100,000 / Damage 1d3 / Armour 5

A famous helm of forged iron granting extraordinary powers of mind andawareness.

Activates: Detect All (every 50 turns)

INTWISSEARCHHIDE_TYPERES_BLINDSEE_INVIS

of Maedhros

Depth 25 / Weight 3.0 lb / Value 62,500 / Damage 2d6

A short thrusting blade with a large guard worn by Maedhros the Tall,eldest son of Feanor, and wielded with his left hand after the loss ofhis right hand in the pits of Thangorodrim.

INTDEXHIDE_TYPESPEEDXTRA_RES_OR_POWERSLAY_TROLLSLAY_GIANTFREE_ACTSEE_INVISSHOW_MODSESP_ORCESP_TROLLESP_GIANT

'Firestar'

Depth 25 / Weight 15.0 lb / Value 35,000 / Damage 2d7

A famed battle-lord of old with a ruddy head, colored as embers are that can yet rise up in wrath.

Activates: Ball Fire (every 50 turns)

BRAND_FIRERES_FIRESHOW_MODSLITE

'Nar-i-vagil'

Depth 25 / Weight 15.0 lb / Value 70,000 / Damage 1d10

Named for a fiery star and set with gems of great worth binding mysticvirtues of protection and thought.

INTHIDE_TYPESLAY_ANIMALBRAND_FIRERES_FIRESHOW_MODSLITE

of Himring

Depth 25 / Weight 10.0 lb / Value 35,000 / Armour 6

Contained within this studded cuirass of pliable leather is the memory ofunvanquished Himring, defiant fortress surrounded by the legions of Morgoth.

Activates: Prot Evil (every 200 turns)

RES_CHAOSRES_NETHERRES_POISAURA_COLD

'Excalibur Jr.'

Depth 25 / Weight 8.0 lb / Value 60,000 / Damage 2d7

Crafted by a legendary wizard and wielded for a long time by the hero Pip,this sword is powerfully magical but notoriously arachnophobic...

BLOWSSLAY_UNDEADSLAY_DRAGONSLAY_ANIMALRES_FIREBLESSEDSLOW_DIGESTSHOW_MODS

'Angrist'

Depth 25 / Weight 1.2 lb / Value 100,000 / Damage 2d5

Forged by Telchar, greatest of the Dwarven smiths, and used by Beren togouge a Silmaril out of Morgoth's crown, this long chopping dagger slicesthrough ordinary metal as easily as its name, "Iron Cleaver", suggests.

DEXHIDE_TYPESTEALTHVORPALBLOWSSLAY_EVILSLAY_TROLLSLAY_ORCBRAND_POISFREE_ACTRES_FEARSUST_DEXSEE_INVIS

of Galadriel

Depth 30 / Weight 1.0 lb / Value 10,000

A small crystal phial, with the light of Earendil's Star contained inside.Its light is imperishable, and near it darkness cannot endure.

Activates: Lite Area (every 15 turns)

SEARCHINSTA_ARTRES_DARK

'Frakir'

Depth 30 / Weight 0.2 lb / Value 10,000

Activates: Drain Life (every 150 turns)

STRINTWISDEXCONCHRSTEALTHHIDE_TYPESPEEDRES_POISSEE_INVISSEARCHWARNING

of Lore

Depth 30 / Weight 1.5 lb / Value 20,000

A great emerald that fills your mind with images of knowledge andunderstanding as you stare into its depths.

Activates: Probing (every 5 turns)

INSTA_ARTINTWISLORE2

of Faramir

Depth 30 / Weight 0.2 lb / Value 20,000

A slim neckpiece of True-silver, with quiet spells of Ithilien to aid andprotect the wearer.

Activates: Pesticide (every 5 turns)

STEALTHSHOW_MODSHIDE_TYPERES_CONFSUST_DEX

'Thalkettoth'

Depth 30 / Weight 6.0 lb / Value 25,000 / Armour 11

An amazingly light tunic and skirt sewn with thick, overlapping scales ofhardened leather whose wearer moves with agility and assurance.

SPEEDDEXHIDE_TYPERES_ACIDRES_SHARDSXTRA_H_RES

of Thranduil

Depth 30 / Weight 1.5 lb / Value 50,000 / Armour 2

The hunting cap of King Thranduil, to whose ears come all the secrets ofhis forest domain.

INTWISHIDE_TYPERES_BLINDTELEPATHYXTRA_H_RES

'Colluin'

Depth 30 / Weight 1.0 lb / Value 80,000 / Armour 1

A cape worn by a hero from Valinor, a land utterly beyond the strifeof Elements.

Activates: Resistance (every 111 turns)

RES_ACIDRES_ELECRES_FIRERES_COLDRES_POIS

'Paurhach'

Depth 30 / Weight 2.5 lb / Value 15,000 / Armour 2

A fiery set of gauntlets that can even burn your opponent.

Activates: Beam Fire (every 12 turns)

RES_FIREBRAND_FIRE

'Pauraegen'

Depth 30 / Weight 2.5 lb / Value 11,000 / Armour 2

A set of handgear with sparks surrounding it, able to shockyour opponent.

Activates: Ball Elec (every 12 turns)

RES_ELECBRAND_ELEC

'Paurnen'

Depth 30 / Weight 2.5 lb / Value 12,000 / Armour 2

A set of handgear so corrosive that dissolves your opponent.

Activates: Bolt Acid (every 12 turns)

RES_ACIDBRAND_ACID

'Glamdring'

Depth 30 / Weight 15.0 lb / Value 40,000 / Damage 2d6

This fiery, shining blade earned its sobriquet "Foe-Hammer" from dying orcswho dared to come near hidden Gondolin.

SEARCHSLAY_EVILBRAND_FIREKILL_ORCRES_FIRERES_LITERES_DARKLITESLOW_DIGESTSHOW_MODSRIDINGFREE_ACTSEE_INVISXTRA_RES_OR_POWERSLAY_ORCSLAY_TROLLSLAY_DEMONESP_ORCESP_TROLLESP_GIANTESP_DEMON

'Nothung'

Depth 30 / Weight 15.0 lb / Value 95,000 / Damage 2d6

SEARCHBRAND_ELECSLAY_ORCKILL_DRAGONRES_ELECLITERES_FIRERES_POISSLOW_DIGESTSHOW_MODSRIDING

'Anduril'

Depth 30 / Weight 13.0 lb / Value 80,000 / Damage 3d6

The famed "Flame of the West", the sword that was broken and is forgedagain. It glows with the essence of fire, its wearer is mighty in combat,and no creature of Sauron can withstand it. It will never be stained orbroken even in defeat.

Activates: Ball Fire (every 40 turns)

STRHIDE_TYPERIDINGXTRA_RES_OR_POWERSLAY_EVILBRAND_FIRESLAY_TROLLSLAY_ORCFREE_ACTRES_FIRESUST_DEXSEE_INVISSHOW_MODSLITEESP_UNDEAD

of Theoden

Depth 30 / Weight 12.0 lb / Value 40,000 / Damage 2d7

The narrow axe head of this weapon, finely balanced by a crow's beak,would pierce even the armour of Smaug, and its wielder becomes aware ofthe minds of their enemies.

Activates: Drain Life (every 100 turns)

WISCONHIDE_TYPEBLESSEDSLAY_DRAGONTELEPATHYSLOW_DIGESTSHOW_MODS

of Eorlingas

Depth 30 / Weight 36.0 lb / Value 100,000 / Damage 3d10

"Forth Eorlingas!". To the field of Celebrant came Eorl the Youngto save beleaguered Gondor, and from his lance fled massive trollsand dire wolves.

STRDEXCHRHIDE_TYPEFREE_ACTSLAY_TROLLSLAY_ORCSEE_INVISSHOW_MODSRIDING

'Avavir'

Depth 30 / Weight 25.0 lb / Value 18,000 / Damage 5d4

With elemental powers whose struggles turn this weapon red and purestwhite, this shining reaper bears within it a power of going forth andreturning.

Activates: Recall (every 100 turns)

DEXCHRHIDE_TYPEBRAND_COLDBRAND_FIREFREE_ACTRES_FIRERES_COLDRES_LITELITESEE_INVISSHOW_MODS

'Goln Nova'

Depth 30 / Weight 15.0 lb / Value 100,000 / Damage 2d6

STRDEXHIDE_TYPEBRAND_MANASHOW_MODSRIDINGKILL_DEMON

'Winblows'

Depth 30 / Weight 50.0 lb / Damage 8d7

DEC_STEALTHDEC_INTDEC_WISAGGRAVATECURSEDHEAVY_CURSESHOW_MODSBRAND_CHAOSIMPACTDEC_SPEEDRANDOM_CURSE0

of Boromir

Depth 30 / Weight 0.2 lb / Value 25,000

A massive golden torque, made of innumerable strands of gold and steelintermingled, with great golden hounds set at either end.

Activates: Scare Monsters (every 60 turns)

SHOW_MODSHIDE_TYPESUST_STRRES_FEAR

Inro of Mito Koumon

Depth 30 / Weight 0.3 lb / Value 100,000

Activates: Mito Koumon (every 225 turns)

INTWISCHRSEARCHINFRASEE_INVISHIDE_TYPEFULL_NAME

'Aranruth'

Depth 30 / Weight 15.0 lb / Value 50,000 / Damage 3d6

The beautiful sword of Thingol, justly named "King's Ire". It glistens icy enough to freeze the hearts of demons, and you feel supple and lightfooted as you clasp its hilt of gold and silver inlay.

Activates: Bolt Cold (every 50 turns)

DEXHIDE_TYPESLAY_DEMONSLAY_ORCFREE_ACTRES_COLDLEVITATIONSLOW_DIGESTSHOW_MODSESP_ORCESP_TROLLESP_GIANTESP_DEMON

'Paurnimmen'

Depth 30 / Weight 2.5 lb / Value 13,000 / Armour 2

A set of handgear so icy as to be able to freeze your opponent.

Activates: Beam Cold (every 12 turns)

RES_COLDBRAND_COLD

of Perseus

Depth 30 / Weight 6.5 lb / Value 45,000 / Damage 1d2 / Armour 5

STRRES_ACIDRES_COLDREFLECTSUST_STR

'Aegis Fang'

Depth 30 / Weight 10.0 lb / Value 100,000 / Damage 3d4

Activates: Heroism (every 45 turns)

STRDEXCHRTUNNELBLESSEDSLAY_EVILSLAY_DRAGONSLAY_ORCSLAY_GIANTSLAY_DEMONRES_COLDSEE_INVISREGEN

of Jing Ke

Depth 30 / Weight 2.0 lb / Value 50,000 / Damage 2d6

DEXBLOWSSPEEDHIDE_TYPEBRAND_COLDBRAND_POISVORPAL

of the Bard

Depth 30 / Weight 2.0 lb / Value 70,000 / Armour 2

DEXCHRSTEALTHRES_POISFREE_ACTHIDE_TYPE

'Stomper'

Depth 30 / Weight 8.0 lb / Value 85,000 / Armour 6

Activates: Earthquake (every 35 turns)

STRCONDEC_STEALTHRES_SHARDSRES_CONFRES_NEXUS

Goblet 'Holy Grail'

Depth 30 / Weight 0.3 lb / Value 60,000

Activates: Holy Grail (every 24 turns)

HIDE_TYPEFULL_NAMEWISCHRRES_NETHER

of Ubbo-Sathla

Depth 30 / Weight 12.0 lb / Value 40,000 / Damage 1d2 / Armour 12

QUESTITEMRES_ACIDRES_ELECRES_FIRERES_COLDRES_CONFRES_CHAOSSTRCONHOLD_LIFESEE_INVISREGEN

of The Multi-hued Centipede

Depth 30 / Weight 2.0 lb / Value 10,000 / Armour 2

QUESTITEMSTRDEXCONSPEEDSTEALTHFREE_ACTRES_ACIDRES_ELECRES_FIRERES_COLDRES_POIS

'VainGlory'

Depth 30 / Weight 15.0 lb / Value 30,000 / Damage 3d7

You swell with pride as you wield this spiked mace.

DEC_WISDEC_STEALTHSLAY_UNDEADSLAY_DRAGONSLAY_DEMONSLAY_EVILSHOW_MODSCURSED

Sword of Tengri

Depth 30 / Weight 13.0 lb / Value 40,000 / Damage 4d5

This sword was a divine gift to a warrior destined for conquest.

Activates: Heroism (every 35 turns)

SLAY_HUMANFULL_NAMESTRCHRRES_FEARFREE_ACTSHOW_MODSBRAND_ELECBRAND_FIRELITE

of Bubo

Depth 30 / Weight 4.0 lb / Value 50,000 / Armour 3

Old leather boots, comfortable yet sturdy and enduring, worn by Bubo on his journeys to the frozen lands of the north.

Activates: Speed (every 100 turns)

RES_FEARRES_COLDRES_DARKCONSTRDEXMAGIC_MASTERY

'Nightcap'

Depth 30 / Weight 0.8 lb / Value 15,000 / Armour 1

A warm woolly hat, ideal for those who creep in cold, dark places.

STEALTHRES_COLDRES_DARKRES_FEARDARKNESSHOLD_LIFEESP_UNDEAD

of the Four Winds

Depth 30 / Weight 0.8 lb / Value 15,000 / Armour 1

A red-and-blue hat with a four-pointed star on top, mystic spells laidupon it to protect its wearer from the elements.

RES_COLDRES_FIRERES_ELECRES_ACID

of the Rohirrim

Depth 35 / Weight 20.0 lb / Value 30,000 / Damage 1d4 / Armour 19

Small metal plates cover an inner layer of sturdy canvas, and both bearscenes of hunting and war. You feel the spirit of Eorl the Young, matchlessin combat, around you as you put his armour on.

STRDEXHIDE_TYPEXTRA_H_RESRES_ACIDRES_ELECRES_COLDRES_CONFRES_SOUND

'Gurthang'

Depth 35 / Weight 20.0 lb / Value 100,000 / Damage 3d7

A giant sword once wielded by mighty Turin, and a great dragonbane whichbathed in Glaurung's blood: but beware, it will drink the blood of thosewho wield it eventually.

STRHIDE_TYPEXTRA_RES_OR_POWERKILL_DRAGONSLAY_TROLLFREE_ACTSLOW_DIGESTREGENSHOW_MODS

'Barukkheled'

Depth 35 / Weight 13.0 lb / Value 50,000 / Damage 2d7

A royal heirloom of the southern coast, strong in combat against evilcreatures of the earth.

CONHIDE_TYPESLAY_EVILSLAY_TROLLSLAY_GIANTSLAY_ORCSEE_INVISSHOW_MODS

'Bloodspike'

Depth 35 / Weight 15.0 lb / Value 50,000 / Damage 2d7

You feel strong and firm of foot as you whip the chain-suspended spiked orbaround - and bathe it in the blood of your foes.

STRHIDE_TYPESLAY_HUMANSLAY_ANIMALSLAY_TROLLSLAY_ORCRES_NEXUSSEE_INVISSHOW_MODS

'Taratol'

Depth 35 / Weight 20.0 lb / Value 50,000 / Damage 3d5

A great ridged mace that calls around you a nimbus of living lightning;you remain utterly untouched even as fat sparks arc around yourfingers and eyebrows.

Activates: Speed (every 100 turns)

KILL_DRAGONBRAND_ELECIM_ELECSHOW_MODS

of Bard

Depth 35 / Weight 0.2 lb / Value 5,000 / Damage 8d4

Deadliest of arrows, imbued with elemental strength, this shaft isfeared especially by the wyrmkin.

KILL_DRAGONINSTA_ARTSHOW_MODS

of Arryu-Chien-Kun

Depth 35 / Weight 7.0 lb / Value 120,000 / Damage 2d10

Activates: Summon Hounds (every 300 turns)

WISDEXHIDE_TYPESLAY_DRAGONSLAY_DEMONSLAY_ANIMALFREE_ACTHOLD_LIFERES_COLDRES_NEXUSSEE_INVISSLOW_DIGESTREGENBLESSEDSHOW_MODSRIDINGESP_ANIMAL

'Quickthorn'

Depth 35 / Weight 5.5 lb / Value 75,000 / Damage 1d8

DEXBLOWSSLAY_DEMONRIDINGSPEEDFREE_ACTSEE_INVISSHOW_MODSRES_CHAOSRES_DISEN

'Aeglos'

Depth 35 / Weight 8.0 lb / Value 140,000 / Damage 3d8

The mighty spear of Gil-galad, famed as "Snow-point" in the songs of Elves,against which all the foul corruptions of Sauron dashed in vain.

Activates: Ball Cold (every 200 turns)

WISHIDE_TYPETHROWINGRIDINGBRAND_COLDSLAY_TROLLSLAY_ORCFREE_ACTRES_COLDSLOW_DIGESTBLESSEDSHOW_MODS

of The Bonze Octopus

Depth 35 / Weight 7.0 lb / Value 125,000 / Damage 1d8

Activates: Summon Octopus (every 400 turns)

STRWISBLOWSTUNNELRES_ACIDRES_ELECREGENFREE_ACTBRAND_ELECBLESSEDXTRA_H_RES

of Wilhelm Tell

Depth 35 / Weight 0.2 lb / Value 5,000 / Damage 6d5

It is said that this bolt sticked onto the heart of Gesslerwhen Wilhelm Tell shot it.

KILL_HUMAN

of Sha Wujing

Depth 35 / Weight 17.5 lb / Value 100,000 / Damage 3d8

This lajatang looks like a staff because it has only ablade which looks like a half moon. Sha Wujing helped along journey of Tang Sanzang with it.

BLESSEDSTRWISSLAY_EVILSLAY_UNDEADKILL_DEMONSEE_INVISREGENINFRARES_ACIDRES_COLDRES_DARK

'Cupid's Arrow'

Depth 35 / Weight 0.2 lb / Value 2,000 / Damage 1d4

This arrow is traditionally shot only by fat, scantily clad babies.

SHOW_MODS

Sword of the Winds

Depth 35 / Weight 13.0 lb / Value 40,000 / Damage 3d6

This sword is light as a feather. The air howls as you swing it.

VORPALRIDINGFULL_NAMEBLOWSSPEEDDEXSHOW_MODS

'Brahmastra'

Depth 35 / Weight 1.5 lb / Value 5,000 / Damage 8d4

The unmatched missile of Brahma, it is more lethal than any other andreturns to the quiver after being fired.

BRAND_FIRESLAY_DEMONINSTA_ARTSHOW_MODSQUESTITEM

of Edison

Depth 40 / Weight 0.5 lb / Value 20,000

Thomas Edison, the "Wizard of Menlo Park," patented 1,093inventions, including the incandescent lightbulb.

INSTA_ARTINFRAAURA_FIREAURA_ELEC

of Arvedui

Depth 40 / Weight 22.0 lb / Value 32,000 / Damage 1d4 / Armour 14

A hauberk, leggings, and sleeves of interlocking steel rings, well paddedwith leather. You feel strong and tall as Arvedui, last king of Arnor,as you put it on.

STRCHRHIDE_TYPEXTRA_H_RESRES_ELECRES_FIRERES_COLDRES_SHARDSRES_NEXUS

'Holcolleth'

Depth 40 / Weight 0.5 lb / Value 43,000 / Armour 4

This elven-grey mantle possesses great powers of tranquility and ofconcealment, and grants the wearer the knowledge and understanding ofthe Sindar.

Activates: Sleep Monsters (every 55 turns)

INTWISSTEALTHHIDE_TYPERES_ACIDSEARCH

'Cambeleg'

Depth 40 / Weight 0.5 lb / Value 36,000 / Armour 1

A hero's handgear that lends great prowess in battle.

STRCONHIDE_TYPEFREE_ACTSHOW_MODS

of Feanor

Depth 40 / Weight 4.0 lb / Value 300,000 / Armour 3

This wondrous pair of leather boots once sped Feanor, creator of theSilmarils and the mightiest of the Eldar, along the Grinding Ice and toMiddle Earth at last.

Activates: Speed (every 200 turns)

SPEEDRES_NEXUS

of Flora

Depth 40 / Weight 2.0 lb / Value 70,000 / Armour 2

Activates: Cure Fear Pois (every 5 turns)

DEXHIDE_TYPECHRSUST_CHRFREE_ACTRES_NETHERRES_CHAOSSUST_CON

of Caine

Depth 40 / Weight 1.2 lb / Value 125,000 / Damage 2d5

DEXHIDE_TYPESTEALTHSEARCHSLAY_HUMANSLAY_EVILSLAY_TROLLSLAY_ORCBRAND_POISFREE_ACTRES_DARKSUST_DEXSEE_INVISSHOW_MODSTHROWING

'Soulsword'

Depth 40 / Weight 13.0 lb / Value 111,111 / Damage 3d6

INTWISLIFESEE_INVISBLESSEDSLAY_ANIMALSLAY_EVILSLAY_UNDEADSLAY_DRAGONSLAY_DEMONRES_CHAOSRES_DISENRES_NEXUSRES_NETHERHOLD_LIFESHOW_MODSXTRA_RES_OR_POWER

'Runespear'

Depth 40 / Weight 10.0 lb / Value 180,000 / Damage 3d11

Gungnir, the spear of Odin, inscribed with mighty runes.

Activates: Ball Elec (every 50 turns)

INTWISHIDE_TYPEBRAND_FIREBRAND_ELECSLAY_TROLLSLAY_ORCSLAY_GIANTFREE_ACTRES_FIRERES_ELECRES_LITESLOW_DIGESTBLESSEDSHOW_MODSLITERIDING

of Balli Stonehand

Depth 40 / Weight 17.0 lb / Value 90,000 / Damage 3d9

The twin blades of this weapon were forged in Belegost, and powerful forcesto resist and endure lie ready for he who shall wield it once more.

STRCONSTEALTHHIDE_TYPESLAY_DEMONSLAY_TROLLSLAY_ORCFREE_ACTRES_ACIDRES_ELECRES_FIRERES_COLDRES_BLINDLEVITATIONSEE_INVISREGENSHOW_MODS

of Buckland

Depth 40 / Weight 2.0 lb / Value 50,000 / Damage x2.75

A sling granting extraordinary clarity of mind amidst darkness andconfusion, and which hurls shot with deadly speed.

SPEEDRES_BLINDRES_CONFSHOW_MODSXTRA_RES_OR_POWER

'Mjollnir'

Depth 40 / Weight 36.0 lb / Value 100,000 / Damage 6d5

The famous throwing hammer of the Norse god Thor, it crackles withlightning as you swing it at your opponents.

BRAND_ELECIM_ELECSTRDEXTHROWINGSLAY_GIANT

Pair~ of Glass Slippers

Depth 40 / Weight 2.0 lb / Value 40,000

DEC_DEXHIDE_TYPESUST_CHRDEC_STEALTHDEC_SPEEDCHRRES_LITERES_DARKRES_NEXUSRES_NETHERRES_CHAOSLITEFULL_NAMEVULN_SHARDS

'Tailbiter'

Depth 40 / Weight 15.0 lb / Value 35,000 / Damage 2d6

The sword of dragon-slayer Bellomarius, and later of Giles. Hidden withinits unassuming blade are powerful spells to detect and slay wyrms.

CONSEARCHBLOWSSLAY_EVILKILL_DRAGONESP_DRAGONSHOW_MODS

of Shuten-douji

Depth 40 / Weight 35.0 lb / Value 100,000 / Damage 4d8

STR

'hermit's purple'

Depth 40 / Weight 3.0 lb / Value 40,000 / Damage 1d7

Activates: Prot Evil (every 225 turns)

INTWISBRAND_MANASEE_INVISTELEPATHY

of Asclepius

Depth 40 / Weight 16.0 lb / Value 300,000 / Damage 2d12

This is the staff of Asclepius, Greek god of medicine.

Activates: Restoring (every 750 turns)

WISCHRBLESSEDLITELIFESEE_INVISFREE_ACTHOLD_LIFEREGENSLOW_DIGESTBRAND_VAMPSLAY_ANIMALSLAY_DRAGONSLAY_HUMANSLAY_ORCSLAY_TROLLSLAY_GIANTRES_POISRES_CONFRES_CHAOS

'Gong'

Depth 40 / Weight 12.0 lb / Value 80,000 / Damage 1d3 / Armour 15

Activates: Gong (every 10 turns)

STRWISHOLD_LIFEREFLECT

of Quaker, Master of Earth

Depth 40 / Weight 0.5 lb / Value 36,000 / Armour 1

QUESTITEMSTRCONHIDE_TYPEFREE_ACTSHOW_MODSIMPACTRES_SHARDS

of Moire, Queen of Rebma

Depth 40 / Weight 3.0 lb / Value 125,000

QUESTITEMSTRCONHIDE_TYPERES_ACIDRES_BLINDRES_CONFSEE_INVISREGENTELEPATHY

of Heracles

Depth 40 / Weight 4.0 lb / Value 60,000 / Damage x3.00

This bow belonged to the greatest of Greek heroes. Itsarrows are coated in the Lernaean Hydra's venom.

STRINTCHRSPEEDBRAND_POISRES_FEAR

of Multi-Skills

Depth 40 / Weight 2.0 lb / Value 100,000 / Armour 2

Wearing these state-of-the-art boots, you feel strong, agile, and healthy... and yet strangely unsure of yourself.

Activates: Expertsexchange (every 100 turns)

SPEEDSTRDEXCONRES_DISENREGENFREE_ACTAGGRAVATENO_ENCHANT

of Dogram

Depth 40 / Weight 0.5 lb / Value 30,000 / Armour 1

The gloves of Dogram the Terrible, master criminal and hybrid-burglarnonpareil.

SPEEDDEXSTEALTHFREE_ACTRES_FEARSUST_DEX

of Ossian

Depth 40 / Weight 6.0 lb / Value 30,000 / Damage 1d2 / Armour 6

This magical shield once protected strong-armed Ossian, who neverbacked away from a struggle.

STRCONREGENREFLECTRES_FEARSUST_STRSUST_CON

of Vidarr

Depth 40 / Weight 8.0 lb / Value 200,000 / Armour 3

The magical shoes of the god Vidarr, crafted from all the spareshoe-leather thrown away by the common folk. With shoes like this youcould even take on the great wolf.

Activates: Stunning Kick (every 80 turns)

SPEEDRES_FIRERES_DARKRES_POISRES_COLDLEVITATIONQUESTITEM

of Kali

Depth 40 / Weight 13.0 lb / Value 111,111 / Damage 5d6

The sword of the divine mother Kali, destroyer of demons.

Activates: Berserk (every 100 turns)

SPEEDBLOWSVORPALBRAND_CHAOSRES_NETHERFREE_ACTHOLD_LIFESLAY_DEMONBLESSEDAGGRAVATEPERMA_CURSEXTRA_RES_OR_POWERDUAL_WIELDINGQUESTITEM

of Mokomagi

Depth 42 / Weight 4.0 lb / Value 30,000 / Damage 2d2

It previously belonged to Katoshiko Mokomagi, a young wizard who started playing with forces beyond his control. (Not a mistake you would ever make.)

INTHIDE_TYPEDEC_MANAEASY_SPELLRES_CONFRES_BLINDSUST_INTQUESTITEM

'Assassinator'

Depth 44 / Weight 1.2 lb / Value 110,000 / Damage 1d5

It is the ultimate weapon of the assassin who prefers to dispatch enemieswhile they sleep.

VORPALSTEALTHDEX

of Caspanion

Depth 45 / Weight 27.0 lb / Value 40,000 / Damage 1d4 / Armour 16

A hauberk, leggings, and sleeves of interlocking steel rings, strategicallyreinforced at vital locations with a second layer of chain. Magics toenhance body and mind lie within, and no door can bar the wearer's path.

Activates: Destroy Trap (every 10 turns)

INTWISCONHIDE_TYPEXTRA_H_RESRES_ACIDRES_POISRES_CONF

'Grayswandir'

Depth 45 / Weight 5.0 lb / Value 125,000 / Damage 2d9

Corwin's mighty blade, decorated with a portion of the Pattern andespecially deadly against creatures of chaos; it is the twin ofBrand's sword Werewindle.

STRDEXCONSUST_CONSUST_STRREGENFREE_ACTSEE_INVISRES_CHAOSRES_NETHERHOLD_LIFERES_COLDBRAND_COLDSLAY_DEMONSLAY_EVILSLAY_DRAGONSLAY_UNDEADSLOW_DIGESTSHOW_MODSHIDE_TYPEBLESSEDRIDING

'Werewindle'

Depth 45 / Weight 13.0 lb / Value 120,000 / Damage 3d6

Brand's mighty Pattern sword, the twin of Corwin's Grayswandir.

Activates: Escape (every 35 turns)

STRCONHIDE_TYPEBRAND_CHAOSREGENSLOW_DIGESTSLAY_EVILBRAND_ELECSLAY_DEMONFREE_ACTRES_ELECRES_LITELITESEE_INVISSHOW_MODSSPEEDSUST_CONSUST_STRSUST_INTSUST_WISRES_DARKRES_DISEN

'Thunderfist'

Depth 45 / Weight 30.0 lb / Value 160,000 / Damage 3d7

The long-lost weapon of Kzurin, Dwarven champion of ancient Belegost,with runes of strength in its handle, and flames and sparks that roar andcrackle around its massive head.

STRHIDE_TYPESLAY_ANIMALBRAND_FIREBRAND_ELECSLAY_TROLLSLAY_ORCRES_ELECRES_FIRERES_DARKSHOW_MODSLITE

of Xiaolong

Depth 45 / Weight 3.0 lb / Value 100,000 / Damage 4d4

STEALTHSUST_STRSUST_DEXSUST_CONSPEEDRES_FIREBRAND_FIRESLAY_ANIMALSLAY_DRAGONFREE_ACTREGENSHOW_MODSHIDE_TYPE

of Benkei

Depth 45 / Weight 40.0 lb / Value 98,765 / Damage 3d7

STRCONSLAY_EVILSLAY_UNDEADSLAY_ORCSLAY_TROLLFREE_ACTREGENSHOW_MODS

'Stormbringer'

Depth 45 / Weight 18.0 lb / Value 100,000 / Damage 6d6

Death is all. Beware, cursed is the wielder.

BRAND_VAMPSTRCONFREE_ACTHOLD_LIFERES_NETHERRES_CONFRES_CHAOSQUESTITEMSLAY_HUMANSLAY_GOOD

'Golden Hammer'

Depth 45 / Weight 5.0 lb / Value 300,000 / Damage 2d7

'Taro Dachi'

Depth 45 / Weight 30.0 lb / Value 120,000 / Damage 9d5

Asakura's captain Naotaka Magara defeated a lot of soldierswith this large katana.

STRVORPALSLAY_HUMANSLAY_ORCSLAY_TROLLSLAY_GIANT

'Silver Hammer'

Depth 45 / Weight 15.0 lb / Value 100,000 / Damage 4d7

And you thought they'd made it up!

BLOWSSTEALTHSLAY_HUMANFREE_ACTRES_FEARRES_ELECBRAND_ELEC

of Tuber

Depth 48 / Weight 4.0 lb / Value 30,000 / Damage x3.50

The bow of sure-aimed Tuber, son of the hero Bubo, imbued with the powersof the frost spirits who once held him captive.

Activates: Stasis Monsters (every 300 turns)

WISBRAND_COLDRES_COLDRES_FEARHIDE_TYPESHOW_MODS

of Elendil

Depth 50 / Weight 0.5 lb / Value 32,500

The shining Star of the West, a famed heirloom of Elendil's house.

Activates: Lite Map Area (every 25 turns)

SEE_INVISHOLD_LIFEINSTA_ARTSPEEDCONCHRREGEN

of Carlammas

Depth 50 / Weight 0.3 lb / Value 60,000

A fiery circle of bronze, with mighty spells to ward off evil.

Activates: Prot Evil (every 300 turns)

CONHIDE_TYPERES_FIRERES_FEAR

of Celegorm

Depth 50 / Weight 6.0 lb / Value 30,000 / Damage 1d2 / Armour 6

This shield emblazoned with a multitude of creatures not seen for agesonce protected Celegorm, lord of Himlad; around it lies a mystic balancethat contains the conflicts of the elements.

RES_ACIDRES_ELECRES_FIRERES_LITERES_DARKXTRA_H_RES

of Hammerhand

Depth 50 / Weight 6.0 lb / Value 45,000 / Damage 1d3 / Armour 6

A great helm as steady as the heroes of the Westdike. Mighty were theblows of Helm, the Hammerhand!

STRDEXCONHIDE_TYPERES_ACIDRES_NEXUSDEC_STEALTHSHOW_MODS

'Terror Mask'

Depth 50 / Weight 7.5 lb / Value 200,000 / Damage 1d3 / Armour 5

Activates: Scare Monsters (every 100 turns)

DEC_INTDEC_WISCHRHIDE_TYPESHOW_MODSSEE_INVISNO_MAGICRES_DISENRES_FEARFREE_ACTRES_ACIDRES_COLDRES_POISTELEPORT

of Jack of Shadows

Depth 50 / Weight 1.0 lb / Value 100,000 / Armour 1

STEALTHSEARCHFREE_ACTSEE_INVISHOLD_LIFETELEPATHY

of Corwin

Depth 50 / Weight 2.5 lb / Value 43,000 / Armour 2

SUST_CONCONREGENRES_COLD

of Fiona

Depth 50 / Weight 1.2 lb / Value 50,000 / Damage 3d5

Activates: Ball Cold (every 7 turns)

DEXHIDE_TYPESPEEDBLOWSBRAND_COLDRES_COLDSEE_INVISSLOW_DIGESTREGENSHOW_MODSBRAND_POISTHROWING

'Calris'

Depth 50 / Weight 14.0 lb / Value 100,000 / Damage 5d5

This sword has runes of power incised on its ornate hilt, and a singleblood channel that gleams coldly blue as you grasp this mighty weapon ofperil.

CONHIDE_TYPEKILL_DRAGONSLAY_EVILSLAY_DEMONSLAY_TROLLRES_DISENSLAY_HUMANDEC_STEALTHCURSEDHEAVY_CURSESHOW_MODSVULN_FIRE

'Aglarang'

Depth 50 / Weight 5.0 lb / Value 150,000 / Damage 8d5

An utterly perfect, cleanly chiseled sword, with a edge that effortlessly slices rock and bone and spells to render the wearer lithe and nimble. It is combat incarnate.

DEXHIDE_TYPEVORPAL2VORPALSUST_DEXSHOW_MODSSPEEDTUNNEL

'Chainsword'

Depth 50 / Weight 13.0 lb / Value 66,666 / Damage 9d6

DEC_DEXDEC_CHRHIDE_TYPEAGGRAVATEVORPAL2VORPALSLAY_HUMANSLAY_TROLLSLAY_ORCSEE_INVISSHOW_MODSESP_ORCESP_TROLLESP_HUMAN

of Durin

Depth 50 / Weight 23.0 lb / Value 150,000 / Damage 4d5

The twin massive axe heads of this ancient demon's dread gleam withmithril inlay, which tell sagas of endurance, invoking the powers ofKhazad-dum to protect the wearer and slay all evils found underground.

CONHIDE_TYPEKILL_DRAGONSLAY_DEMONSLAY_TROLLSLAY_ORCFREE_ACTRES_ACIDRES_FIRERES_LITERES_DARKRES_CHAOSSHOW_MODS

of Eonwe

Depth 50 / Weight 23.0 lb / Value 200,000 / Damage 4d5

The axe of Eonwe, leader of the Hosts of the West before the gates ofThangorodrim, strikes with icy wrath at the undead, disperses hosts ofevil at a word, and grants Maia-like powers of body and mind.

Activates: Mass Genocide (every 1000 turns)

STRINTWISDEXCONCHRHIDE_TYPESLAY_EVILBRAND_COLDSLAY_UNDEADSLAY_ORCFREE_ACTIM_COLDSEE_INVISBLESSEDSHOW_MODS

of the Dwarves

Depth 50 / Weight 25.0 lb / Value 80,000 / Damage 3d9

A massive axe with twin razor-sharp heads, so large that it usuallyrequires two hands to wield, intricately engraved in gold with spellsto ward off the elements and smite evil.

SLAY_EVILTUNNELINFRASEARCHSLAY_GIANTRES_ACIDRES_ELECRES_FIRERES_COLDSHOW_MODS

'Kusanagi-no-tsurugi'

Depth 50 / Weight 12.0 lb / Value 123,456 / Damage 4d4

Activates: Escape (every 35 turns)

STEALTHDEXRES_NETHERRES_DISENRES_ACIDRES_ELECRES_FIRERES_COLDSLAY_EVILSLAY_ANIMALSLAY_DEMONSLAY_DRAGONSEE_INVISREGENBLESSEDLITESHOW_MODS

of Incanus

Depth 50 / Weight 2.0 lb / Value 100,000 / Armour 2

The robe of the great wizard Gandalf, also known as Incanus in thelands of the South. It is proof against elements, for neither theheat of the South, nor the ice of the North, nor the acidic pits of DolGuldur were able to hold back the defiant Maia in the pursuit ofhis mission.

Activates: Bolt Mana (every 120 turns)

INTWISSEARCHHIDE_TYPELEVITATIONSUST_INTSUST_WISFREE_ACTSEE_INVISDEC_MANARES_ACIDRES_ELECRES_FIRERES_COLDSPELL_CAP

of Hurin

Depth 50 / Weight 18.0 lb / Value 120,000 / Damage 3d7

"Hurin [...] wielded the axe two-handed, and it is sung that the axe smoked in the black blood of the troll-guard of Gothmog, until it withered, and each time that he slew Hurin cried 'Aure entuluva! Day shall come again!'. Seventy times he uttered that cry, but they took him at last alive, by the command of Morgoth..."

Activates: Speed Hero (every 200 turns)

CONBLOWSHIDE_TYPEBRAND_ACIDSHOW_MODSSLAY_TROLLSLAY_DEMON

'Silver Chariot'

Depth 50 / Weight 7.5 lb / Value 100,000 / Damage 2d7

DEXBLOWSSLAY_EVILSLAY_UNDEADSLAY_ORCSLAY_DEMONFREE_ACTSEE_INVISSHOW_MODSRES_DARKRES_DISENSPEED

'Worpal Blade'

Depth 50 / Weight 15.0 lb / Value 100 / Damage 5d6

It is a look-alike for the strongest sword!

TY_CURSEAGGRAVATEDRAIN_EXPINFRANO_TELENO_MAGICHIDE_TYPEVULN_FIREVULN_COLDVULN_ELECVULN_ACIDVULN_POISVULN_CONFVULN_CHAOS

of Yoichi

Depth 50 / Weight 4.0 lb / Value 30,000 / Damage x4.00

DEXHIDE_TYPESEE_INVISSHOW_MODS

'Zantetsuken'

Depth 50 / Weight 12.0 lb / Value 80,000 / Damage 8d5

STRDEXVORPALTUNNELSHOW_MODS

'Hrunting'

Depth 50 / Weight 25.0 lb / Value 100,000 / Damage 4d7

STRHIDE_TYPEVORPALSLAY_DRAGONKILL_GIANTFREE_ACTLITELEVITATIONSHOW_MODS

'Tonbo giri'

Depth 50 / Weight 40.0 lb / Value 250,000 / Damage 4d11

STRDEXHIDE_TYPESEARCHFREE_ACTSLAY_HUMANSLAY_TROLLSLAY_GIANTSLAY_ANIMALSLAY_ORCRES_FIRERES_COLDRES_ELECRES_ACIDSHOW_MODSRIDING

of Musashi

Depth 50 / Weight 12.0 lb / Value 60,000 / Damage 3d5

It is the katana of the famed creator of the dual sword technique,Miyamoto Musashi, and wielded with his right hand in combat.

DEXHIDE_TYPESUST_DEXSHOW_MODS

of Musashi

Depth 50 / Weight 9.0 lb / Value 60,000 / Damage 2d5

It is the wakizashi of the famed creator of the dual sword technique,Miyamoto Musashi, and wielded with his left hand in combat.

DEXHIDE_TYPESUST_DEXSHOW_MODS

'Excalipur'

Depth 50 / Weight 13.0 lb / Damage 5d6

DEC_WISDEC_CHRVULN_FEARTY_CURSEAGGRAVATEDRAIN_EXPSHOW_MODSTHROWING

of Earendil

Depth 50 / Weight 16.0 lb / Value 90,000 / Damage 1d6 / Armour 10

A shining shield, once borne by the great mariner Earendil, "scored withrunes to keep all wounds and harm from him".

Activates: Curing (every 100 turns)

LITERES_BLINDRES_DARKRES_NETHERRES_ELECRES_FIREESP_GOOD

'Ama-no-NumaHoko'

Depth 50 / Weight 24.0 lb / Value 150,000 / Damage 2d10

Activates: Ball Water (every 250 turns)

WISCHRSUST_WISSUST_CHRHIDE_TYPESLAY_EVILSLAY_DEMONSLAY_UNDEADRES_ACIDRES_COLDRES_BLINDRES_CHAOSLITEBLESSEDSEE_INVISSHOW_MODS

of Mook

Depth 50 / Weight 3.0 lb / Value 50,000 / Armour 3

Activates: Resist Cold (every 60 turns)

RES_COLDRES_ACIDRES_CHAOSLEVITATION

of The Pitch Dark Night

Depth 50 / Weight 0.2 lb / Value 50,000

Activates: Ball Dark (every 100 turns)

STEALTHSEARCHHIDE_TYPESEE_INVISRES_DARKDARKNESS

of Eowyn

Depth 50 / Weight 14.0 lb / Value 120,000 / Damage 4d5

STRCHRSTEALTHSPEEDSLAY_EVILKILL_UNDEADSLAY_GIANTSLAY_ANIMALRES_NETHERRES_FEARRES_DARKRES_COLD

of Sacred Knights

Depth 50 / Weight 0.2 lb / Value 77,777

Activates: Sacred Knights

STRWISHIDE_TYPERES_CONFRES_CHAOSBLESSEDSEE_INVISFREE_ACTREGENHOLD_LIFE

Harness of the Hell

Depth 50 / Weight 3.0 lb / Value 66,666

Activates: Ball Dark (every 100 turns)

DEC_INTDEC_WISCHRDEC_STEALTHDEC_SPEEDHIDE_TYPEFULL_NAMERES_DARKRES_NETHERSEE_INVISAGGRAVATEESP_UNDEAD

Charmed Pendant

Depth 50 / Weight 0.2 lb / Value 100,000

Activates: Restore Mana (every 777 turns)

INTCHRINFRASEARCHHIDE_TYPEFULL_NAMESEE_INVISFREE_ACTSLOW_DIGESTREGENLITEWARNINGAURA_FIREAURA_ELECAURA_COLDEASY_SPELLMAGIC_MASTERY

of Gogo

Depth 50 / Weight 0.2 lb / Value 55,555

INTWISDEXSEE_INVISLITE

of Hellfire

Depth 50 / Weight 11.0 lb / Value 60,000 / Damage x4.00

This crossbow gives flame energy to bolts which it fires.

STRINFRARES_FIREAURA_FIREHIDE_TYPESHOW_MODSBRAND_FIRE

of Wilhelm Tell

Depth 50 / Weight 11.0 lb / Value 50,000 / Damage x4.00

With this crossbow, Swiss hero Tell shot an apple exactlythough it was on his son's head, and then he defeated evilmagistrate Gessler.

DEXHIDE_TYPESEE_INVISSHOW_MODSSLAY_HUMAN

of the Heavenly Maiden

Depth 50 / Weight 0.0 lb / Value 45,000

This is a heavenly cloak of the maiden which was stolenby a man, when she was having a bath at a lake with herfriend maidens.

Activates: Recall (every 200 turns)

CHRLEVITATIONSEE_INVISFREE_ACTAGGRAVATERES_COLDRES_ELECXTRA_H_RESXTRA_POWER

of Yositsune

Depth 50 / Weight 6.0 lb / Value 96,000 / Damage 1d2 / Armour 7

This is Yositsune's kabuto. It defended his head againstmany arrows and blades from his enemies.

DEXCONCHRSEARCHINFRAHIDE_TYPERES_FEARRES_BLINDRES_SOUNDWARNINGESP_HUMAN

of Yositsune

Depth 50 / Weight 20.0 lb / Value 40,000 / Damage 1d4 / Armour 17

This is the haramakido of Yositsune who is the best bravewarrior of Genji. You can feel his agility and dexterity,when you put it on.

DEXSPEEDSTEALTHHIDE_TYPEFREE_ACTREGENSLOW_DIGESTRES_ACIDRES_FIRERES_COLDRES_ELECRES_CONFRES_CHAOSRES_NEXUS

of Aragorn

Depth 50 / Weight 2.0 lb / Value 30,000 / Armour 4

STRDEXWISSPEEDHIDE_TYPESTEALTHFREE_ACTRES_ELECRES_FIRERES_COLD

of the Duelist

Depth 50 / Weight 3.0 lb / Value 150,000 / Damage 1d8

Activates: Strafing (every 3 turns)

BRAND_VAMPSHOW_MODSSPEEDDEXINTFREE_ACT

of the Defender of the Crown

Depth 50 / Weight 20.0 lb / Value 150,000 / Damage 5d5

A rather clumsy but large ball-and-chain forged of iron.It emits a curiously muted bell-like tone when you strikeyour foes.

Activates: Stone Skin (every 300 turns)

STRCONLITEHIDE_TYPESLAY_EVILSLAY_HUMANSLAY_DEMONRES_SOUNDRES_SHARDSRES_NETHERHOLD_LIFE

'Big Punch'

Depth 50 / Weight 80.0 lb / Value 150,000 / Damage 8d5

This gigantic, dull-gray mace was rumored to be a giftfrom an ancient dwarven king to an adventurer for savinghis people from a fearsome demon.

HIDE_TYPESHOW_MODSRES_SOUND

'Ballista'

Depth 50 / Weight 20.0 lb / Value 60,000 / Damage x5.00

Activates: Piercing Shot (every 100 turns)

HIDE_TYPESHOW_MODSSTRRES_CONF

of the Kamikaze Warrior

Depth 50 / Weight 2.0 lb / Value 80,000 / Armour 2

This robe is stained with the the blood of many fallen heroes.So much death. So much destruction. What could cause such a thing?

Activates: Berserk (every 100 turns)

STRDEXDEC_WISSPEEDHIDE_TYPESUST_STRSUST_DEXHOLD_LIFELEVITATIONRES_FIRERES_POISRES_CONFRES_SOUNDRES_NETHERRES_FEARNO_MAGICWEAPONMASTERYNO_ENCHANT

& Stone of Nature

Depth 50 / Weight 2.0 lb / Value 100,000

At first glance, it appears to be just an ordinary rock.But as you grasp the stone it emits an earthly glow, and youbegin to feel yourself in tune with the world around you.

Activates: Stone Skin (every 100 turns)

FULL_NAMEINSTA_ART

& Stone of Life

Depth 50 / Weight 2.0 lb / Value 100,000

Activates: Restoring (every 500 turns)

FULL_NAMEHOLD_LIFELIFEINSTA_ART

& Sorcerer's Stone

Depth 50 / Weight 2.0 lb / Value 100,000

Activates: Recharge From Player (every 10 turns)

FULL_NAMEINTINSTA_ART

& Stone of Chaos

Depth 50 / Weight 2.0 lb / Value 100,000

Activates: Poly Self (every 500 turns)

FULL_NAMERES_CHAOSINSTA_ART

& Stone of Death

Depth 50 / Weight 2.0 lb / Value 100,000

Activates: Animate Dead (every 666 turns)

FULL_NAMERES_NETHERINSTA_ART

& Trump Card

Depth 50 / Weight 2.0 lb / Value 100,000

Activates: Teleport

FULL_NAMECHRINSTA_ART

& Brimstone

Depth 50 / Weight 2.0 lb / Value 100,000

Activates: Ball Fire (every 666 turns)

FULL_NAMEINSTA_ART

& Crusader's Stone

Depth 50 / Weight 2.0 lb / Value 100,000

Activates: Prot Evil (every 250 turns)

FULL_NAMEWISINSTA_ART

& Stone of Craft

Depth 50 / Weight 2.0 lb / Value 100,000

Activates: Resistance (every 100 turns)

FULL_NAMESPEEDINSTA_ART

& Stone of War

Depth 50 / Weight 2.0 lb / Value 100,000

Activates: Berserk (every 100 turns)

FULL_NAMEFREE_ACTINSTA_ART

of the Undertaker

Depth 50 / Weight 25.0 lb / Value 50,000 / Damage 7d2

TUNNELRES_POISRES_NETHERRES_DARKSLAY_HUMANBRAND_VAMPBRAND_POIS

& Armageddon Stone

Depth 50 / Weight 2.0 lb / Value 100,000

Activates: Destruction (every 10 turns)

FULL_NAMEINSTA_ART

of Devouring Darkness

Depth 50 / Weight 0.2 lb / Value 10,000 / Damage 1d2

QUESTITEMSTEALTHSEE_INVISHOLD_LIFEFREE_ACTRES_BLINDRES_DARKRES_NETHERRES_POISVULN_LITE

Dog Collar of Carcharoth

Depth 50 / Weight 3.0 lb / Value 66,666

QUESTITEMHIDE_TYPEFULL_NAMERES_FEARTELEPATHY

of the Hydra

Depth 50 / Weight 0.5 lb / Value 70,000

Activates: Heal Curing (every 300 turns)

QUESTITEMINSTA_ARTSPEEDSUST_CONSUST_STRREGENRES_POIS

of Ulik

Depth 50 / Weight 40.0 lb / Value 150,000 / Damage 5d8

QUESTITEMSTRCONKILL_TROLL

of Ariel, Queen of Air

Depth 50 / Weight 0.0 lb / Value 45,000

QUESTITEMLEVITATIONSEE_INVISFREE_ACTRES_COLDRES_ELECSPEEDDEX

of Loge, Spirit of Fire

Depth 50 / Weight 15.0 lb / Value 250,000 / Damage 5d6

QUESTITEMVORPALBRAND_FIRERES_FIRESTRDEX

'Dramborleg'

Depth 50 / Weight 23.0 lb / Value 21,000 / Damage 4d5

This is the great axe, used by Tuor, that bothcuts and stuns its foes. With this axe, Tuor slewfive balrogs in the battle of Gondolin. It wasbelieved lost in the drowning of Numenor.

STRCONINFRAHIDE_TYPEKILL_DEMONVORPALSTUNRES_BLINDRES_DARKRES_DISENREGEN

& Meditation Stone

Depth 50 / Weight 2.0 lb / Value 100,000

Activates: Restore Mana (every 777 turns)

FULL_NAMEWISINSTA_ART

of Thrain

Depth 50 / Weight 2.0 lb / Value 100,000

A great globe seemingly filled with moonlight, the famed Heart of theMountain. It splinters the light that falls upon it into ten thousandsparks of white radiance shot with glints of the rainbow.

Activates: Clairvoyance (every 150 turns)

SEE_INVISHOLD_LIFERES_LITERES_DARK

'Micro$oft Edge'

Depth 50 / Weight 48.0 lb / Damage 6d6

It feels so sharp you might cut yourself.

DEC_INTDEC_WISAGGRAVATECURSEDHEAVY_CURSEVORPAL2BRAND_VAMPBRAND_CHAOSDEC_SPEEDSLAY_GOODDRAIN_EXPRANDOM_CURSE0

Lava Lamp of Telmora

Depth 50 / Weight 0.5 lb / Value 70,000

Activates: Confusing Lite (every 50 turns)

QUESTITEMINSTA_ARTRES_FIRERES_SOUNDBRAND_FIREAURA_FIRECHRFULL_NAME

of Surveillance

Depth 50 / Weight 0.3 lb / Value 60,000

This amulet reveals all the secrets of the world. You're very glad it'snot in less responsible hands...

Activates: Probing (every 10 turns)

CHRSTEALTHHIDE_TYPEFREE_ACTSEE_INVISTELEPATHYESP_NONLIVING

Pumpkin Lamp of Jack of Lanterns

Depth 50 / Weight 6.0 lb / Value 50,000

A soft light shines from the depths of this carved pumpkin. (You hope itisn't the glow of damned souls...)

STEALTHCHRRES_COLDRES_ELECRES_FIREESP_HUMANLITEQUESTITEMFULL_NAME

Falcon Cloak of Freyja

Depth 50 / Weight 3.0 lb / Value 50,000 / Armour 3

The magical feathered cloak of Freyja, the twin of Frigg's cloak.It allows anyone who wears it access to the skies.

SPEEDRES_LITERES_COLDFREE_ACTLEVITATIONFULL_NAMEQUESTITEM

Falcon Cloak of Frigg

Depth 50 / Weight 3.0 lb / Value 50,000 / Armour 3

The magical feathered cloak of Frigg, the twin of Freyja's cloak. It allowsanyone who wears it access to the skies.

SPEEDRES_NEXUSTELEPATHYLEVITATIONFULL_NAMEQUESTITEM

Mom's Loving Modular Sniper Crossbow

Depth 50 / Weight 11.0 lb / Value 100,000 / Damage x5.05

The great masterpiece of Mom's Loving Arms Company, it is capable ofshooting any ammunition.

HIDE_TYPESHOW_MODSFULL_NAME

Stress Ball

Depth 50 / Weight 0.3 lb / Value 10,000

Activates: Unfocus Rage (every 30 turns)

FULL_NAMEINSTA_ARTRES_FEARBLESSED

of the Dawn

Depth 55 / Weight 13.0 lb / Value 250,000 / Damage 3d6

Forged in the farthest East by a race of mighty spellcasters, thisshiny pale sword gleams with the rays of rising sun as you invokeits power of commanding legions of powerful immortal warriors...

Activates: Summon Dawn (every 750 turns)

LITEBRAND_FIREFREE_ACTRES_FIREINFRARIDINGSLAY_EVILSLAY_DRAGONSLAY_UNDEADSLAY_DEMONVORPALCHRSUST_CHRRES_LITERES_BLINDREGENSHOW_MODSXTRA_RES_OR_POWER

'Gae Bulg'

Depth 55 / Weight 8.0 lb / Value 150,000 / Damage 3d8

Activates: Ball Lite (every 200 turns)

STRDEXHIDE_TYPETHROWINGBRAND_ELECSLAY_EVILSLAY_GIANTRES_ELECRES_LITERES_DARKLITESEE_INVISRES_BLINDSHOW_MODSRIDING

of The Padre

Depth 55 / Weight 34.0 lb / Value 80,000 / Damage 1d6 / Armour 23

CHRREFLECTRES_FIRERES_CHAOSLITE

'Dragonic Sword'

Depth 55 / Weight 20.0 lb / Value 180,000 / Damage 4d7

Activates: Ball Elec (every 50 turns)

STRSLAY_EVILSLAY_DEMONBRAND_ELECRES_ELECRES_FIRERES_NETHERLITESEE_INVISSHOW_MODS

Mithril Spear of Liweris

Depth 55 / Weight 10.0 lb / Value 80,000 / Damage 3d11

Forged from stolen mithril for the evil king of Liweris, it is imbuedwith dark powers that make it a mortal enemy of all things good, and deadlyto dragonkind. The city of Liweris was razed by dragons as soon as the wordgot out, and the king died in flames; but his spear survived.

DEC_WISSLAY_GOODKILL_DRAGONHIDE_TYPEFULL_NAMEHEAVY_CURSERIDINGRANDOM_CURSE0

'Black Belet'

Depth 56 / Weight 0.8 lb / Value 50,000 / Armour 1

The legendary black hat of Aijem the walrus, sewn in the mists of time, andrumoured to keep its owner's mind and body ever fresh.

RES_SOUNDRES_TIMERES_FEARSUST_STRSUST_INTSUST_WISSUST_DEXSUST_CONSUST_CHRREGENRES_FIRERES_DISENFREE_ACTHOLD_LIFESEE_INVISRES_CONFESP_HUMANESP_ANIMAL

Palantir of Westernesse

Depth 60 / Weight 1.0 lb / Value 60,000

A shining white ball of unbreakable crystal, the ancient palantiri,or 'far-watchers', were used by kings of Numenor and later by the Exilesfor rapid communication between distant lands.

Activates: List Uniques (every 200 turns)

WISCHRTELEPATHYINSTA_ARTFULL_NAMEFIXED_ACT

of Anarion

Depth 60 / Weight 12.0 lb / Value 160,000 / Damage 1d3 / Armour 8

The great metal-bound shield of Anarion, son of Elendil, who Sauron foundhimself powerless to wither or diminish.

RES_ACIDRES_ELECRES_FIRERES_COLDSUST_STRSUST_INTSUST_WISSUST_DEXSUST_CONSUST_CHRXTRA_H_RES

of Indra

Depth 60 / Weight 1.5 lb / Value 100,000 / Armour 2

INTWISCHRSUST_INTSUST_WISSUST_CHRRES_BLINDIM_ELEC

of Fingolfin

Depth 60 / Weight 4.0 lb / Value 110,000 / Armour 5

The hand-sheathing of Fingolfin, warrior-king of Elves and Men, who gaveMorgoth seven mighty wounds and pain that will last forever.

Activates: Arrow (every 50 turns)

DEXHIDE_TYPEFREE_ACTRES_ACIDSHOW_MODSXTRA_POWER

of Thror

Depth 60 / Weight 8.0 lb / Value 85,000 / Armour 6

Sturdy footwear of leather and steel as enduring as the long-sufferingDwarven King-in-exile who wore them. Of dwarven make, the wearer ofthese boots will be completely at home in the mountains.

STRCONHIDE_TYPESPEEDXTRA_H_RES

of Shiva's Avatar

Depth 60 / Weight 2.0 lb / Value 100,000 / Armour 4

SPEEDDEXSUST_DEXRES_NEXUSFREE_ACTLEVITATION

'Crisdurian'

Depth 60 / Weight 26.0 lb / Value 111,000 / Damage 4d6

A giant's weapon, with a long blade tall and straight thrusting out from amassive double-pronged hilt. On its blade are written doomspells againstboth the living and undead.

SLAY_DRAGONSLAY_EVILSLAY_UNDEADSLAY_TROLLSLAY_GIANTSLAY_HUMANSLAY_ORCSEE_INVISSHOW_MODSVORPALBRAND_POIS

of Pain

Depth 60 / Weight 19.0 lb / Value 50,000 / Damage 9d7

The massive chopper that crowns this glaive glows blood-red and black;fell spells of annihilation swirl and dance as you swing death's myrmidondown.

SHOW_MODSRIDING

'Slayer'

Depth 60 / Weight 26.0 lb / Value 200,000 / Damage 5d6

BLOWSBRAND_VAMPHOLD_LIFESLAY_UNDEADSLAY_EVILSLAY_HUMANREGENRES_BLINDSLOW_DIGESTSHOW_MODS

of Bard

Depth 60 / Weight 4.0 lb / Value 40,000 / Damage x4.00

The great yew bow of grim-faced Bard, who shot the mightiest arrow thatsongs record.

DEXHIDE_TYPEFREE_ACTSHOW_MODS

of Numenor

Depth 60 / Weight 4.0 lb / Value 50,000

A crown of massive gold, set with wondrous jewels of thought and warding, worn by the kings of ancient Numenor.

INTDEXCHRHIDE_TYPERES_SHARDSRES_SOUNDRES_LITELITE

of Laputa

Depth 60 / Weight 1.0 lb / Value 60,000

Activates: Ball Mana (every 250 turns)

INTCHRSPEEDLEVITATIONHOLD_LIFEINSTA_ART

'Excalibur'

Depth 60 / Weight 13.0 lb / Value 300,000 / Damage 5d6

WISCHRSUST_WISSUST_CHRVORPALTUNNELRIDINGSLAY_EVILSLAY_UNDEADSLAY_DEMONRES_SHARDSRES_FEARBLESSEDHOLD_LIFESEE_INVISWARNINGSHOW_MODS

of Guan Yu

Depth 60 / Weight 32.0 lb / Value 200,000 / Damage 4d6

STRDEXCONSLAY_EVILSLAY_HUMANVORPALSHOW_MODS

of Nain

Depth 60 / Weight 25.0 lb / Value 80,000 / Damage 3d8

Wielded by Nain of the Iron Hills at the Battle of Azanulbizar, this greatmattock brought victory to the Dwarves over Azog's Orcs - though Nainhimself fell at the last, even with victory already assured.

Activates: Stone To Mud (every 2 turns)

TUNNELINFRASEARCHSTRSLAY_ORCSLAY_TROLLSLAY_GIANTSLAY_DRAGONBRAND_ACIDRES_ACIDRES_DARKRES_DISEN

of Gothmog

Depth 60 / Weight 9.0 lb / Value 66,666 / Damage 3d7

With this unbearably bright whip of flame, the Balrog Gothmog has become known for never having lost in combat.

Activates: Ball Fire (every 15 turns)

QUESTITEMSTRDEC_WISDEXCONCHRDEC_STEALTHHIDE_TYPESLAY_HUMANBRAND_FIRESLAY_ANIMALSLAY_ORCSLAY_TROLLSLAY_GIANTIM_FIRERES_ELECRES_DARKVULN_COLDLITESHOW_MODS

of Bilbo

Depth 60 / Weight 7.0 lb / Value 200,000 / Damage 1d4 / Armour 28

"Also there is this!" said Bilbo, bringing out a parcel which seemedto be rather heavy for its size. He unwound several folds of old cloth,and held up a small shirt of mail. It was close-woven of many rings,as supple almost as linen, cold as ice, and harder than steel. It shonelike moonlit silver, and was studded with white gems.

STEALTHSEE_INVISDEXSPEEDRES_ACIDRES_ELECRES_FIRERES_COLDRES_POISRES_DARKXTRA_H_RES

'Great Maul of Vice'

Depth 60 / Weight 70.0 lb / Value 500,000 / Damage 8d8

This curious object is the favorite of many a female of everyspecies. Those who find themselves in a proximity of one seemto constantly lose cash, and it seems impossible to leave its presence.

Activates: Light Speed (every 888 turns)

CONCHRBRAND_VAMPBRAND_ELECBRAND_POISFREE_ACTHOLD_LIFERES_NETHERRES_NEXUSRES_FEAR

of Ancalagon

Depth 60 / Weight 2.0 lb / Value 100,000 / Damage 3d9

STRDEXBLOWSBRAND_ACIDIM_ACIDXTRA_H_RESXTRA_RES_OR_POWER

of Khazad-dum

Depth 60 / Weight 40.0 lb / Value 80,000 / Damage 4d8

"The Dwarves delved too greedily and too deep. You know whatthey awoke in the darkness of Khazad-dum: Shadow and Flame!"

TUNNELINFRAREGENSTRCONRES_BLINDSLAY_EVILRES_DISENDEC_STEALTH

of Dragonkind

Depth 60 / Weight 3.0 lb / Value 125,000

QUESTITEMHIDE_TYPESTRINTWISDEXCONCHRSPEEDRES_COLDRES_FIRERES_ACIDRES_ELECRES_POISHOLD_LIFEREGENXTRA_H_RES

of Eyes

Depth 60 / Weight 4.0 lb / Value 50,000

Activates: Clairvoyance (every 30 turns)

QUESTITEMSEE_INVISTELEPATHYRES_BLINDRES_DISENWARNINGINTSEARCH

'Dragonlance'

Depth 60 / Weight 50.0 lb / Value 1,000,000 / Damage 6d10

STRCHRKILL_DRAGONRIDINGBLESSEDRES_ACIDRES_ELECRES_FIRERES_COLDRES_POIS

'Impaler'

Depth 60 / Weight 45.0 lb / Value 1,000,000 / Damage 5d10

Activates: Charge (every 100 turns)

SLAY_HUMANSLAY_GIANTSLAY_TROLLBRAND_POISRIDING

Midnight Dragon Scale Mail

Depth 60 / Weight 0.0 lb / Value 200 / Damage 2d4 / Armour 40

A suit of utterly black scales, against which no metal or wood can rest.

Activates: Breathe Acid (every 40 turns)

RES_ACIDBRAND_ACIDRES_DARKDARKNESSFULL_NAME

'Skynail'

Depth 60 / Weight 15.0 lb / Value 150,000 / Damage 4d6

A shining blade so sturdy it could even hold the stars in place.

SLAY_EVILBRAND_FIRERES_COLDRES_DARKLITESHOW_MODSRIDINGXTRA_RES_OR_POWERSPEEDSTRDEXRES_CHAOSVORPALBLESSED

of Sotkamo

Depth 60 / Weight 1.5 lb / Value 50,000 / Damage 2d4

You feel agile and able to withstand the ravages of time as you hold thisold club and swing it. Now, if only it had been designed for bashingyour enemies' heads in...

Activates: Restoring (every 75 turns)

SPEEDDEXREFLECTFREE_ACTSUST_DEXRES_NEXUSRES_TIMEHOLD_LIFEREGENINSTA_ARTQUESTITEM

of the Visiting Team

Depth 60 / Weight 2.0 lb / Value 50,000 / Damage 2d4

A memento of your adventures in Zul, you presume it must have eitherbelonged to one of the strange mages or fallen out of a hole in space-time.

SPEEDDEXREFLECTRES_SOUNDSUST_DEXINSTA_ARTQUESTITEMDEC_CHRRES_NEXUSMAGIC_MASTERYSTUN

'Superbat'

Depth 60 / Weight 2.0 lb / Value 40,000 / Damage 2d4

It was carved out of a tree branch knocked down by a falling meteor.(You're not sure if that gives it any mystic superpowers, but you surehope so.)

STRDEXCHRREFLECTRES_FEARFREE_ACTRES_NEXUSREGENDEC_INTLIFETELEPATHYINSTA_ARTQUESTITEM

of Amun

Depth 60 / Weight 1.2 lb / Value 100,000 / Damage 3d5

An ancient, well-balanced steel blade with beautiful decorations on itsgolden hilt, once held by Amun the everliving. Despite its age, the daggerremains shiny and razor-sharp.

Activates: Telepathy (every 100 turns)

BRAND_FIREBRAND_POISIM_FIRERES_POISINTSPEEDRES_LITERES_ELECRES_SOUNDSTEALTHSEARCHFREE_ACTSEE_INVISHIDE_TYPEVORPALSLAY_TROLLBLESSED

of the Hypnotoad

Depth 60 / Weight 0.5 lb / Value 100,000

Activates: Eye Hypno (every 6 turns)

FREE_ACT

'Urog'

Depth 60 / Weight 30.0 lb / Value 180,000 / Damage 6d6

The ultimate reward for your loyal service: Karrot's massive blade ofshadows, which no ordinary man could wield. A chilling darkness strikesyour enemies with every blow as you proudly swing it.

Activates: Ball Dark (every 100 turns)

STRCONCHRRES_DARKRES_DISENSHOW_MODSVORPALSEE_INVISINFRADARKNESSSEARCHSLAY_GIANTDEC_STEALTHBRAND_VAMPSPEEDBRAND_DARKQUESTITEMFIXED_ART

'Jarngreipr'

Depth 60 / Weight 4.0 lb / Value 110,000 / Armour 5

The iron gloves of Magni the mighty, inherited from his father. They givetheir wearer such strength that Thor's hammer will feel light as a feather.

STRRES_ELECHIDE_TYPEQUESTITEMSHOW_MODS

of Rama

Depth 60 / Weight 4.0 lb / Value 40,000 / Damage x4.25

The great bow of prince Rama, avatar of Vishnu, famous for his unmatchedbowmanship. Crafted by the divine builder Vishwakarma, it originallybelonged to Vishnu himself.

Activates: Rama Arrow (every 20 turns)

WISSTEALTHSLAY_DEMONSLAY_EVILHIDE_TYPESHOW_MODSSUST_WISSLOW_DIGESTPERMA_CURSEQUESTITEM

of Ingwe

Depth 65 / Weight 0.3 lb / Value 90,000

The ancient heirloom of Ingwe, high lord of the Vanyar, against whom nothingof evil could stand.

Activates: Dispel Evil (every 300 turns)

WISCHRINFRAHIDE_TYPESEE_INVISFREE_ACTRES_ACIDRES_COLDRES_ELEC

of Isildur

Depth 65 / Weight 30.0 lb / Value 50,000 / Damage 2d4 / Armour 25

A gleaming steel suit covering the wearer from neck to foot, with runes ofwarding and stability deeply engraved into its surface.

CONRES_ACIDRES_FIRERES_COLDXTRA_H_RESRES_SOUNDRES_CONFRES_NEXUS

'Yasaka-no-Magatama'

Depth 65 / Weight 0.3 lb / Value 90,000

Activates: Recall (every 200 turns)

INTCHRSEARCHHIDE_TYPESEE_INVISFREE_ACTRES_FIRERES_COLDRES_ELEC

'Yata-no-Kagami'

Depth 65 / Weight 5.0 lb / Value 150,000

Activates: Dispel Evil (every 300 turns)

INSTA_ARTSEE_INVISREFLECTLITERES_LITEINTWISTELEPATHYHOLD_LIFEHIDE_TYPE

of Fundin Bluecloak

Depth 65 / Weight 13.0 lb / Value 150,000 / Damage 4d5

The weapon of one of the great dwarven priests, with powersto preserve body and soul, and the bane of thosewho seek life beyond death.

Activates: Dispel Evil (every 100 turns)

STRWISSPEEDLITEHIDE_TYPESLAY_EVILSLAY_UNDEADRES_FIRERES_ELECRES_NETHERHOLD_LIFE

of Mr. Shine

Depth 65 / Weight 10.0 lb / Value 65,000 / Damage 1d2 / Armour 10

You could almost believe it was made of diamond.

CHRINTRES_SHARDSRES_POISRES_LITEHIDE_TYPEREFLECTWISSUST_INTSUST_WISSUST_CHR

'Dragonchip'

Depth 65 / Weight 0.3 lb / Value 70,000

A golden amulet of unparallelled craftsmanship, shaped like a flying dragonand inlaid with precious gems. Powerful runes have been inscribed upon it,and no magic, whether the wearer's or an enemy's, can function properlynear it.

CHRNO_MAGICMAGIC_RESISTANCEIGNORE_INVULN

Pendant 'Efki'

Depth 65 / Weight 0.3 lb / Value 50,000

A powerful rune of speed has been inscribed on this protective talisman.You feel calm and safe from dangers with its reassuring weight around yourneck, knowing there are few enemies you cannot outrun.

Activates: Speed (every 150 turns)

SPEEDRES_FEARHOLD_LIFEFULL_NAME

of Lakshmi

Depth 65 / Weight 0.3 lb / Value 90,000

This pendant inlaid with a shining gem was worn by Lakshmi, the wiseand beautiful goddess of prosperity, until that fateful day when amurdering looter invaded her home.

Activates: Satisfy Hunger (every 25 turns)

CHRLITEINFRAHIDE_TYPESEE_INVISFREE_ACTSUST_CHRSEARCHRES_LITERES_DARKRES_CHAOSREGENQUESTITEMBLESSEDHOLD_LIFE

of Thanos

Depth 66 / Weight 2.5 lb / Armour 2

STRDEXHIDE_TYPERES_DISENRES_NEXUSIM_FIREKILL_LIVINGHOLD_LIFERES_NETHERRES_CONFRES_CHAOSRES_POISIM_COLDAGGRAVATECURSEDSHOW_MODSHEAVY_CURSETY_CURSETELEPORTRANDOM_CURSE1

'Muramasa'

Depth 66 / Weight 20.0 lb / Value 1,000,000 / Damage 10d6

Activates: Muramasa

HIDE_TYPEBLOWSVORPAL2BRAND_VAMPSLAY_HUMANSLAY_GOODSHOW_MODSSPEEDRES_DISENNO_TELEVORPALDRAIN_EXPAGGRAVATERES_DARKRES_NETHERTY_CURSE

'Stone Mask'

Depth 66 / Weight 7.5 lb / Damage 1d3 / Armour 5

Activates: Scare Monsters (every 100 turns)

STRCONINFRAHIDE_TYPESHOW_MODSRES_CONFRES_NETHERRES_COLDRES_POISRES_DARKRES_FEARSEE_INVISDRAIN_EXPAURA_COLDHOLD_LIFELEVITATIONREGEN

'Iron ball'

Depth 66 / Weight 66.6 lb / Value 66,666 / Damage 22d5

DEC_SPEEDDEC_STEALTHDEC_WISSTRIMPACTSHOW_MODSHIDE_TYPECURSEDHEAVY_CURSE

'Bloodrip'

Depth 66 / Weight 15.0 lb / Value 166,666 / Damage 6d6

This weapon is infused with the soul of the first Blood Knight. Beware!It longs for blood, even the wielder's! But there is no finer weapon forthose who walk the red path.

Activates: Whirlwind Attack (every 66 turns)

CONHIDE_TYPESHOW_MODSVORPALBRAND_VAMPFREE_ACTSEE_INVISSLAY_GOODRES_CONFRES_SOUNDDEC_STEALTH

of Saruman

Depth 66 / Weight 4.0 lb / Value 100,000 / Damage 3d2

Activates: Resistance (every 111 turns)

INTHIDE_TYPEDEC_MANAREGENRES_FIRERES_COLDRES_ACIDRES_ELECBRAND_VAMPBRAND_POISBRAND_MANASPELL_CAP

of Vecna

Depth 66 / Weight 0.1 lb / Value 666,666

It is a charred and rotting vestige of the oncegreat Emperor Lich.

CHRFREE_ACTPERMA_CURSEQUESTITEMINSTA_ARTNO_ENCHANT

of Vecna

Depth 66 / Weight 0.1 lb / Value 666,666

It is a shriveled vestige of the oncegreat Emperor Lich.

Activates: Eye Vecna (every 30 turns)

INTSPELL_CAPNIGHT_VISIONTELEPATHYPERMA_CURSEQUESTITEMINSTA_ART

of Judgement

Depth 70 / Weight 0.5 lb / Value 150,000

Activates: Jewel (every 30 turns)

SEE_INVISHOLD_LIFERES_CONFRES_CHAOSINSTA_ARTSPEEDWISINT

Necklace of the Dwarves

Depth 70 / Weight 0.3 lb / Value 75,000

The Nauglamir; a carencet of gold set with a multitude of shining gems ofValinor, accenting a radiant Silmaril. The sturdy spirits of Dwarvishcraftsmen who labored long in mountain smithies lie within it still, andas gossamer it rests upon the bearer.

STRCONLIFEINFRAHIDE_TYPERES_BLINDDEC_STEALTHSEE_INVISFREE_ACTREGENLITEFULL_NAME

of Tulkas

Depth 70 / Weight 0.2 lb / Value 35,000

The treasure of Tulkas, most fleet and wrathful of the Valar.

Activates: Speed Hero (every 225 turns)

STRDEXCONHIDE_TYPESPEED

of Power (Narya)

Depth 70 / Weight 0.2 lb / Value 100,000

The Ring of Fire, set with a ruby that glows like flame. Narya is oneof the three Rings of Power created by the Elves and hidden by them fromSauron.

Activates: Ball Fire (every 50 turns)

STRINTWISDEXCONCHRSPEEDHIDE_TYPEFREE_ACTSEE_INVISSLOW_DIGESTREGENSUST_STRSUST_DEXIM_FIREBRAND_FIREWEAPONMASTERYXTRA_SHOTSFIXED_ART

of Shiva's Avatar

Depth 70 / Weight 12.0 lb / Value 100,000 / Damage 1d2 / Armour 12

BLOWSRES_SHARDSHOLD_LIFESLOW_DIGESTSUST_STRSUST_DEXSUST_CONSUST_INTSUST_WISSUST_CHRRES_ACIDRES_ELECRES_FIRERES_COLD

of Thorin

Depth 70 / Weight 6.5 lb / Value 120,000 / Damage 1d2 / Armour 5

Invoking the strength and endurance of Thorin, King under the Mountain,this little metal shield is proof against the Element of Earth.

STRCONHIDE_TYPEFREE_ACTIM_ACIDRES_SOUNDRES_CHAOSXTRA_H_RES

of Dor-Lomin

Depth 70 / Weight 7.5 lb / Value 300,000 / Damage 1d3 / Armour 8

The legendary dragon helm of Turin Turambar, an object of dread to theservants of Morgoth.

Activates: Scare Monsters (every 100 turns)

STRDEXCONHIDE_TYPERES_ACIDRES_ELECRES_FIRERES_COLDRES_LITERES_BLINDLITESEE_INVISTELEPATHY

of Luthien

Depth 70 / Weight 0.5 lb / Value 80,000 / Armour 6

The opaque midnight folds, inset with a multitude of tiny diamonds, ofthis cloak swirl around you and you feel a hint, a fragment of theknowledge and power to restore that lay in Luthien, the most beautifulbeing that ever knew death.

Activates: Restore Exp (every 450 turns)

INTWISCHRHIDE_TYPESPEEDSTEALTHRES_ACIDRES_FIRERES_COLDRES_DARKRES_LITEXTRA_H_RES

of Tuor

Depth 70 / Weight 0.5 lb / Value 50,000 / Armour 6

From the ruin of Gondolin did Tuor escape, through secret ways and travail,shielded by his cloak from a multitude of hostile eyes.

STEALTHFREE_ACTIM_ACIDSEE_INVISRES_DARKRES_LITEXTRA_H_RES

'Twilight'

Depth 70 / Weight 25.0 lb / Damage 4d7

Surtur's sword of doom, bringer of death and destruction even to the gods.

QUESTITEMSPEEDIM_FIRERES_FIREBRAND_FIRERES_DISENSHOW_MODSLITE

'Ringil'

Depth 70 / Weight 13.0 lb / Value 300,000 / Damage 5d6

The weapon of Fingolfin, High King of the Noldor; it shines like a columnof ice lit by light unquenchable. Morgoth came unwillingly to meet itof old; his lame foot will remind him of its might should he meet it again.

Activates: Ball Cold (every 200 turns)

SPEEDREGENSHOW_MODSRIDINGCHRSLAY_EVILBRAND_COLDSLAY_UNDEADSLAY_DEMONSLAY_TROLLFREE_ACTRES_COLDRES_LITELITESEE_INVISSLOW_DIGESTESP_ORCESP_TROLLESP_GIANT

of Destiny

Depth 70 / Weight 10.0 lb / Value 80,000 / Damage 3d11

Activates: Stone To Mud (every 5 turns)

INTWISINFRAHIDE_TYPESEARCHBRAND_FIRESLAY_GIANTSLAY_EVILSLAY_DEMONSLAY_UNDEADSLAY_DRAGONRES_FIRERES_LITEHOLD_LIFELEVITATIONLITESEE_INVISBLESSEDSHOW_MODSRIDING

of Wrath

Depth 70 / Weight 30.0 lb / Value 90,000 / Damage 3d10

A massive triple-pronged spear, so great it normally requires two hands towield, evoking the spirit of Osse who with it pierced legions ofevil and undead.

STRDEXHIDE_TYPEBRAND_CHAOSSLAY_EVILSLAY_UNDEADRES_LITERES_DARKSEE_INVISBLESSEDSHOW_MODSRIDING

of Ulmo

Depth 70 / Weight 7.0 lb / Value 120,000 / Damage 4d10

The awesome weapon of the Vala Ulmo, Lord of Waters. Mightiest of all thepowers of good save Manwe himself, Ulmo laughs in scorn at the dread powersof the undead, and is utterly in command of the element of water.

Activates: Teleport Away (every 50 turns)

DEXHIDE_TYPEXTRA_POWERSLAY_DRAGONSLAY_ANIMALFREE_ACTHOLD_LIFEIM_ACIDRES_NETHERSEE_INVISSLOW_DIGESTREGENBLESSEDSHOW_MODSRIDING

'Belthronding'

Depth 70 / Weight 4.0 lb / Value 60,000 / Damage x3.00

The great bow of Beleg Cuthalion, made of black yew and strung with elvenhair that faintly shimmers a pale clear gold.

DEXSTEALTHHIDE_TYPERES_DISENXTRA_SHOTSSHOW_MODS

of Brand

Depth 70 / Weight 11.0 lb / Value 100,000 / Damage x4.25

SPEEDRES_FIRESHOW_MODSXTRA_RES_OR_POWERBRAND_FIREQUESTITEM

of Gil-galad

Depth 70 / Weight 10.0 lb / Value 65,000 / Damage 1d2 / Armour 10

The legendary shield of Gil-galad, who fought his way to the gates of the Dark Tower, and with whom came light even to Gorgoroth.

Activates: Ball Lite (every 100 turns)

LITECHRRES_ELECRES_ACIDHIDE_TYPEREFLECTSUST_WISSUST_CHR

'Soulcrusher'

Depth 70 / Weight 18.0 lb / Value 250,000 / Damage 6d6

SLAY_DEMONSTRCONSLAY_UNDEADBRAND_FIRESLAY_HUMANSUST_STRFREE_ACTRES_ACIDRES_DISENRES_FIRERES_COLDRES_CHAOSSEE_INVISTELEPATHYAGGRAVATEDRAIN_EXPSHOW_MODSBRAND_CHAOSCURSEDHEAVY_CURSELITE

of Falis

Depth 70 / Weight 13.0 lb / Value 80,000 / Damage 4d6

KILL_DEMONSTRKILL_EVILKILL_UNDEADBRAND_FIREKILL_TROLLKILL_ORCFREE_ACTRES_FIRERES_ACIDRES_COLDRES_ELECSUST_STRSEE_INVISSHOW_MODSLITEBLESSED

of Destruction

Depth 70 / Weight 3.0 lb / Value 100,000 / Damage 3d7

STRDEXBLOWSBRAND_CHAOSCURSEDHEAVY_CURSETY_CURSEAGGRAVATEBRAND_FIREBRAND_COLDBRAND_ELECBRAND_ACIDBRAND_POISSPEED

'Bloody Moon'

Depth 70 / Weight 25.0 lb / Value 180,000 / Damage 8d4

Activates: Bloody Moon (every 500 turns)

of the Bando Musha

Depth 70 / Weight 32.0 lb / Value 50,000 / Damage 1d4 / Armour 24

This is Shigetada Hatakeyama's O-yoroi. He is brave, wiseand honest warrior, so he was called the best model ofeastern samurai. This O-yoroi is majestic like him.

STRCONCHRHIDE_TYPESHOW_MODSRES_ACIDRES_COLDRES_ELECRES_BLINDRES_DISENRES_FEARXTRA_H_RES

of Eternity

Depth 70 / Weight 0.0 lb / Value 100,000

This robe is invisible to the naked eye. It's a wonder you found it at all! Yet,it holds an incredible power, undiluted by time.

CONSUST_STRSUST_INTSUST_WISSUST_DEXSUST_CONSUST_CHRFREE_ACTLEVITATIONSEE_INVISHOLD_LIFERES_LITERES_DARKRES_DISENRES_TIME

of Daeron

Depth 70 / Weight 4.0 lb / Value 200,000 / Damage x0.00

Daeron is mentioned as the greatest minstrel of all the Children of Iluvatar,and only Maglor son of Feanor is said to come close to his skill.

Activates: Heal Curing Hero (every 300 turns)

WISCONCHRSUST_WISSUST_CONSUST_CHRSEE_INVISREFLECTRES_FIRERES_ELECRES_LITERES_POISFIXED_ART

of Rygar

Depth 70 / Weight 15.0 lb / Value 150,000 / Damage 3d9

This curious weapon with an oversized head seems to flail out withamazing ease. In fact, it seems to leap out several times on its ownwithout your trying.

STRDEXBLOWSHIDE_TYPESLAY_HUMANSLAY_ANIMALSLAY_EVILSLAY_DRAGONSEE_INVISFREE_ACTSHOW_MODS

'Ruyi Jingu Bang'

Depth 70 / Weight 16.0 lb / Value 300,000 / Damage 2d11

The magic cudgel of The Monkey King, Sun Wukong, this iron rod hasthe power to change its size at the will of its master.

Activates: Enlarge Weapon (every 100 turns)

SLAY_ANIMALSLAY_DEMONSLAY_UNDEADFREE_ACTRES_SOUNDHOLD_LIFESUST_STRSUST_DEXBLOWSSPEEDSTRDEXCONWIS

of the Ages

Depth 70 / Weight 0.2 lb / Value 100,000

Forged you know not when, this ring seems to have withstood the test of time.

CONSUST_STRSUST_INTSUST_WISSUST_DEXSUST_CONSUST_CHRRES_TIMEHOLD_LIFE

of Ymir

Depth 70 / Weight 40.0 lb / Damage 5d10

QUESTITEMSTRDEC_DEXCONVULN_FIREIM_COLDRES_COLDBRAND_COLDVORPAL

of Typhoeus

Depth 70 / Weight 40.0 lb / Damage 5d12

QUESTITEMIM_ELECRES_ELECBRAND_ELECVORPAL

'Bloodthirster'

Depth 70 / Weight 66.6 lb / Value 250,000 / Damage 50d1

QUESTITEMSHOW_MODSPERMA_CURSEFREE_ACTSEE_INVISRES_CONFRES_CHAOSAGGRAVATESLAY_DRAGONSLAY_EVILSLAY_HUMANBRAND_ACIDBRAND_ELECDEC_STRDEC_INTDEC_WISDEC_DEXDEC_CONDEC_SPEEDDEC_LIFE

'Kaladanda'

Depth 70 / Weight 50.0 lb / Value 150,000 / Damage 7d8

The staff of Death, this mighty, lethal hammer was usedby the God Yama and is the ultimate weapon. None canwithstand its wrath!

STRRES_COLDBRAND_VAMPBRAND_COLDSLAY_GOODSLAY_LIVINGHOLD_LIFESUST_STRSUST_INTSUST_WISSUST_DEXSUST_CONSUST_CHR

of Kundry

Depth 70 / Weight 0.2 lb / Value 50,000

A shining golden pendant with powerful magics stored within to keep its wearer's mind clear.

Activates: Clarity (every 30 turns)

QUESTITEMHIDE_TYPEMAGIC_MASTERYMAGIC_RESISTANCERES_TIMESEARCHHOLD_LIFESUST_INTSUST_WISSUST_CHR

& All-Seeing Eye

Depth 70 / Weight 0.5 lb / Value 100,000

Activates: Detect All (every 5 turns)

FULL_NAMEINSTA_ARTRES_BLINDSEE_INVISTELEPATHYNIGHT_VISIONSEARCHRES_LITERES_DARKPERMA_CURSE

'Gjallarhorn'

Depth 70 / Weight 2.5 lb / Value 100,000

The great horn of the god Heimdall, claimed to ring so loud it can beheard in all nine worlds.

Activates: Return Pets (every 20 turns)

CHRSUST_CHRRES_FEARDEC_STEALTHESP_GIANTESP_UNDEADFIXED_ACTQUESTITEM

of Tyr

Depth 70 / Weight 34.0 lb / Value 100,000 / Damage 1d6 / Armour 23

The armour of the god Tyr, upholder of law and justice.

Activates: Heroism (every 10 turns)

RES_ACIDRES_ELECRES_COLDRES_SOUNDRES_SHARDSWISCONRES_CHAOSRES_BLINDRES_FEARFREE_ACTSLOW_DIGESTQUESTITEM

Necklace 'Brisingamen'

Depth 70 / Weight 0.3 lb / Value 75,000

The beautiful necklace of the goddess Freyja, reputed to be the work ofdwarven masters.

CONCHRINFRAHIDE_TYPERES_LITERES_FIRERES_DARKFREE_ACTSEE_INVISREGENLITESUST_STRSUST_CONSUST_WISSUST_INTSUST_DEXSUST_CHRFULL_NAMEDEC_STEALTH

of Krishna

Depth 70 / Weight 0.5 lb / Value 100,000

The flute of Krishna, avatar of Vishnu. The gopis always heard when heplayed it, even if they were far away.

Activates: Return Pets (every 5 turns)

WISCHRSUST_WISSUST_CHRFREE_ACTSEE_INVISREGENQUESTITEMESP_HUMANHOLD_LIFERES_ACIDSLOW_DIGESTFIXED_ACT

of Shiva

Depth 70 / Weight 7.0 lb / Value 90,000 / Damage 3d10

The great trishula of Shiva himself, destroyer of everything and bringerof a new, monster-free world.

Activates: Dispel Evil (every 250 turns)

STRDEXINTWISCONCHRHIDE_TYPEQUESTITEMSUST_STRSUST_DEXSUST_INTSUST_WISSUST_CONSUST_CHRVORPALBRAND_ELECBRAND_FIRESLAY_EVILSEE_INVISBLESSEDSHOW_MODSRIDING

'Kaustubha'

Depth 70 / Weight 0.5 lb / Value 150,000

The shining gem of Vishnu, which the gods churned forth from the milkyocean.

Activates: Ball Lite (every 100 turns)

SEE_INVISHOLD_LIFERES_DARKRES_DISENQUESTITEMPERMA_CURSELORE2INSTA_ARTSPEEDWISINTESP_DEMON

'Syamantaka'

Depth 70 / Weight 0.5 lb / Value 150,000

This gem once belonged to the sun-god Surya, and no other jewel can matchits brightness; yet death and destruction follow its wearer.

Activates: Confusing Lite (every 10 turns)

SPEEDCHRIM_FIRERES_LITEAURA_FIRERES_CHAOSSLOW_DIGESTAGGRAVATETY_CURSEPERMA_CURSE

of Saraswati

Depth 70 / Weight 1.5 lb / Value 10,000 / Armour 2

The headwear of Saraswati, the goddess of knowledge and learning.

Activates: Probing (every 5 turns)

SPEEDINTWISMAGIC_MASTERYLORE2SUST_INTSUST_WISQUESTITEM

Space Suit of Vayu

Depth 70 / Weight 44.0 lb / Value 80,000 / Damage 1d2 / Armour 18

This strange jacket is uncomfortably heavy, but allows its wearer tobreathe normally in airless environments.

RES_ELECRES_COLDRES_DARKRES_SOUNDRES_CHAOSLEVITATIONSEARCHDEC_DEXFULL_NAMEQUESTITEM

Unlight Cloak of Ungoliant

Depth 70 / Weight 0.0 lb / Value 50,000 / Armour 6

A cloak of darkness; an Unlight which eyes cannot pierce, for it is void.

STEALTHINFRASEARCHRES_POISRES_DARKRES_BLINDSEE_INVISVULN_LITEDARKNESSESP_ANIMALFULL_NAMEHOLD_LIFEQUESTITEM

'Soulkeeper'

Depth 75 / Weight 42.0 lb / Value 200,000 / Damage 2d4 / Armour 50

A suit of imperishable adamant, with conquerable strength to endure eviland disruptive magics, that protects the life force of its wearer likenothing else can.

Activates: Heal (every 888 turns)

CONHOLD_LIFESUST_CONRES_ACIDRES_COLDRES_DARKRES_NETHERRES_NEXUSRES_CHAOS

of Julian

Depth 75 / Weight 25.0 lb / Value 120,000 / Damage 2d4 / Armour 15

Activates: Genocide (every 500 turns)

STRCHRHIDE_TYPERES_ACIDRES_ELECRES_FIRERES_COLDRES_DARKRES_DISENXTRA_H_RESESP_ANIMAL

Spectral Dragon Scale Mail

Depth 75 / Weight 10.0 lb / Value 350,000 / Damage 2d4 / Armour 40

A white transparent dragon scale mail which was made fromthe tortured soul of a once powerful wyrm.

AURA_COLDRES_COLDRES_POISRES_CONFRES_NETHERRES_NEXUSRES_DISENSEE_INVISHOLD_LIFELEVITATIONDEC_STRDEC_DEXDEC_CONDEC_LIFESTEALTHCURSEDHEAVY_CURSEFULL_NAME

of Freyr

Depth 75 / Weight 15.0 lb / Value 150,000 / Damage 4d6

The blazing sword of the god Freyr, the loss of which is fated to doom himin battle against the fire-giant Surtur.

SPEEDBLOWSDEXVORPALLITEBRAND_FIRESLAY_GIANTSLAY_DEMONRES_FIRERES_SOUNDFREE_ACTREGENRIDINGBLESSEDSHOW_MODSWISXTRA_POWER

Gada of Hanuman

Depth 75 / Weight 50.0 lb / Value 50,000 / Damage 9d5

The massive mace of the god Hanuman, most mortals lack the strength tohandle it.

STRRES_FEARSTUNSLAY_DEMONSHOW_MODSQUESTITEMFULL_NAMESLOW_DIGEST

of Power (Nenya)

Depth 80 / Weight 0.2 lb / Value 200,000

The Ring of Adamant, with a pure white stone as centerpiece. Nenya is oneof the three Rings of Power created by the Elves and hidden by them fromSauron.

Activates: Ball Cold (every 50 turns)

STRINTWISDEXCONCHRSPEEDHIDE_TYPEHOLD_LIFEFREE_ACTSEE_INVISLEVITATIONREGENSUST_INTSUST_WISIM_COLDBRAND_COLDXTRA_POWERWEAPONMASTERYXTRA_SHOTSFIXED_ART

'Crimson'

Depth 80 / Weight 10.0 lb / Value 100,000 / Damage x0.00

Activates: Rocket (every 15 turns)

STEALTHRES_SHARDSXTRA_POWERXTRA_H_RESINSTA_ARTNO_ENCHANTFIXED_ACT

of Lohengrin

Depth 80 / Weight 15.0 lb / Value 135,000 / Damage 1d4 / Armour 28

Activates: Heal Curing Hero (every 300 turns)

STEALTHWISINTSEE_INVISRES_ACIDRES_ELECRES_FIRERES_COLDRES_POISHOLD_LIFERES_NETHERRES_DARKRES_FEAR

of Amber

Depth 80 / Weight 3.0 lb / Value 125,000

Activates: Heal (every 250 turns)

STRWISCONHIDE_TYPESPEEDRES_FIRERES_LITERES_BLINDRES_ELECRES_CONFRES_CHAOSLITESEE_INVISREGENXTRA_POWERXTRA_H_RES

of Aule

Depth 80 / Weight 12.0 lb / Value 250,000 / Damage 5d7

The wondrous hammer of Aule, creator of the wise Dwarven lords of old.It bears magics of demolishing that no serpent or demon can withstand, andinvokes the strength of mountains to ward off the tumult of the elements.

WISHIDE_TYPEKILL_DRAGONSLAY_EVILBRAND_ELECSLAY_UNDEADSLAY_DEMONFREE_ACTRES_ACIDRES_ELECRES_FIRERES_COLDRES_NEXUSSEE_INVISSHOW_MODSXTRA_POWERXTRA_H_RES

of Gandalf

Depth 80 / Weight 4.0 lb / Value 140,000 / Damage 4d2

The staff of the great wizard Gandalf.It is tall and sturdy, with rough-hewn runes that invoke the element ofEarth, and which strikes down all creatures who live in the shadow ofmountains.

Activates: Invulnerability (every 777 turns)

INTWISCHRHIDE_TYPESEARCHBRAND_FIREBRAND_MANASLAY_EVILSLAY_TROLLSLAY_ORCLITEDEC_MANAXTRA_POWERHOLD_LIFERES_FIRERES_NETHERSEE_INVISSHOW_MODSREGENREGEN_MANASLOW_DIGESTRES_CONFRES_BLINDSPELL_CAP

'Deathwreaker'

Depth 80 / Weight 40.0 lb / Value 444,444 / Damage 7d8

A weapon so massive it seems beyond the strength of mortals, yet you feelthe might of giants within you as you heft it. As you grip the handleof ebony and steel, coronas of fire blaze and mighty spells to preservemagic activate around you. You wield the Fear of Dragons and the Despairof the Undead!

STRTUNNELHIDE_TYPENO_TELESLAY_HUMANSLAY_DRAGONSLAY_ANIMALSLAY_EVILSLAY_UNDEADBRAND_FIREIM_FIRERES_DARKRES_CONFRES_CHAOSRES_DISENAGGRAVATELITESHOW_MODSBRAND_POISBRAND_VAMPRIDING

'Nyoi-bou'

Depth 80 / Weight 50.0 lb / Value 300,000 / Damage 7d8

STRSLAY_EVILSEE_INVISRIDING

of Anubis

Depth 80 / Weight 12.0 lb / Value 200,000 / Damage 3d5

CHRBRAND_CHAOSCURSEDHEAVY_CURSETUNNELAGGRAVATEBLOWSRES_CONFRES_CHAOSRES_DISENNO_TELE

'Gurenki'

Depth 80 / Weight 13.0 lb / Value 100,000 / Damage 5d6

VORPALBRAND_VAMPSLAY_EVILKILL_DEMONESP_DEMONAGGRAVATELITECON

'Elemental of Ching-Rong'

Depth 80 / Weight 30.0 lb / Value 200,000 / Damage 2d4 / Armour 40

Activates: Resistance (every 111 turns)

RES_ACIDRES_FIRERES_COLDRES_ELECRES_DARKRES_CONFRES_POISFREE_ACTSEE_INVIS

of Maglor

Depth 80 / Weight 4.0 lb / Value 200,000 / Damage x0.00

Maglor, son of Feanor and Nerdanel, was the greatest poet and bard of the Noldor.

Activates: Restore Mana (every 777 turns)

STRINTCHRSUST_STRSUST_INTSUST_CHRFREE_ACTHOLD_LIFERES_DARKRES_NETHERRES_BLINDFIXED_ART

of Aegir

Depth 80 / Weight 40.0 lb / Value 150,000 / Damage 4d7

The mighty black stone club of the sea-god Aegir, crafted fromhot magma quarried from a volcano in the blackest depths of hiswatery domain. Although a jovial soul in nature, Aegir isterrifying to behold when angered. You feel the contained ragewithin this heavy truncheon, awaiting your command to be released.

Activates: Summon Kraken (every 500 turns)

STRCONCHRRES_COLDSLAY_EVILSLAY_UNDEADSLAY_DEMONBRAND_COLD

of the Emperor Lich

Depth 80 / Weight 3.0 lb / Value 125,000

QUESTITEMHIDE_TYPEINTCHRSPEEDRES_COLDRES_ELECRES_POISRES_NETHERRES_DARKRES_LITEDEC_MANASPELL_CAPREGENXTRA_H_RES

of the Emperor Quylthulg

Depth 80 / Weight 3.0 lb / Value 125,000

QUESTITEMCHRSPEEDFREE_ACTTELEPATHYRES_BLINDRES_CONFRES_CHAOSSEE_INVISREGENXTRA_H_RES

of Skadi

Depth 80 / Weight 3.0 lb / Value 66,666 / Damage x3.75

The bow of the giantess Skadi, a great hunter and the wife of the god Njord.

DEXSTEALTHRES_COLDBRAND_COLDXTRA_SHOTSQUESTITEM

of Ullur

Depth 80 / Weight 0.2 lb / Value 10,000

The ring of Ullur, god of archery and the hunt.

Activates: Speed (every 200 turns)

SPEEDDEXSTEALTHXTRA_SHOTSQUESTITEM

'Railgun'

Depth 85 / Weight 10.0 lb / Value 80,000 / Damage x0.00

Activates: Beam Lite (every 15 turns)

IM_FIRERES_LITENO_ENCHANTINSTA_ARTFIXED_ACT

of Power (Vilya)

Depth 90 / Weight 0.2 lb / Value 300,000

The Ring of Sapphire, with clear blue gems that shine like stars,glittering untouchable despite all that Morgoth ever wrought. Vilya isone of the three Rings of Power created by the Elves and hidden by themfrom Sauron.

Activates: Ball Elec (every 50 turns)

STRINTWISDEXCONCHRSPEEDHIDE_TYPEHOLD_LIFEFREE_ACTSEE_INVISLEVITATIONSLOW_DIGESTREGENSUST_INTSUST_WISSUST_STRSUST_DEXIM_ELECBRAND_ELECXTRA_POWERWEAPONMASTERYXTRA_SHOTSFIXED_ART

of Beruthiel

Depth 90 / Weight 2.0 lb

The midnight-hued steel circlet of the sorceress-queen Beruthiel, whichgrants extraordinary powers of sight and awareness at a terrible physicalcost.

DEC_STRDEC_DEXDEC_CONDEC_LIFEHIDE_TYPEDEC_MANAEASY_SPELLFREE_ACTSEE_INVISTELEPATHYXTRA_POWERSPELL_POWERREGEN_MANACURSEDHEAVY_CURSEPERMA_CURSE

'Zarcuthra'

Depth 90 / Weight 25.0 lb / Value 205,000 / Damage 6d7

Dark and deadly runes stand stark against the naked steel of this awesomeweapon, and you feel a stunning power of slaying and rending as youslowly approach.

STRCHRINFRAHIDE_TYPEVORPALXTRA_RES_OR_POWERSLAY_HUMANKILL_DRAGONSLAY_ANIMALSLAY_EVILBRAND_FIRELITESLAY_UNDEADSLAY_DEMONSLAY_TROLLSLAY_GIANTSLAY_ORCSLAY_GOODRES_FIRERES_CONFRES_CHAOSFREE_ACTSEE_INVISAGGRAVATESHOW_MODS

'Vorpal Blade'

Depth 90 / Weight 15.0 lb / Value 250,000 / Damage 5d6

"One, two! One, two! And through, and through, the vorpal bladewent snicker-snack!"

VORPAL2SLAY_EVILHIDE_TYPEVORPALFREE_ACTLITESEE_INVISSLOW_DIGESTREGENSPEEDSTRDEXCHR

'Razorback'

Depth 90 / Weight 50.0 lb / Value 400,000 / Damage 2d4 / Armour 40

A massive suit of heavy dragon scales deeply saturated with many colors.It throbs with angry energies, and you feel the raw elemental might ofuntamed Lightning as you put it on.

Activates: Star Ball (every 1000 turns)

RES_FIRERES_COLDRES_POISRES_LITERES_DARKRES_ACIDLITESEE_INVISAGGRAVATEFREE_ACTIM_ELEC

of The High Priest of Morlok

Depth 90 / Weight 20.0 lb / Value 100,000 / Damage 1d4 / Armour 14

INTWISCHRHIDE_TYPERES_LITERES_DARKRES_ACIDRES_ELECRES_FIRERES_COLDRES_POISRES_CONFRES_CHAOSRES_NETHERRES_NEXUSAGGRAVATECURSEDHEAVY_CURSETY_CURSEDEC_STRDEC_DEXDEC_CONSPELL_POWER

of Kaschei

Depth 90 / Weight 4.0 lb / Value 300,000 / Damage 3d2

CURSEDHEAVY_CURSEPERMA_CURSEAGGRAVATEDRAIN_EXPDEC_STRDEC_DEXDEC_CONSPELL_POWERDEC_MANAINTRES_POISRES_NETHERRES_DARKRES_DISEN

of Zeus

Depth 90 / Weight 0.2 lb / Value 555,555

This is the charm worn by Zeus, King of the Olympians and Bane of the Titans.

Activates: Ball Elec (every 5 turns)

SPEEDMAGIC_MASTERYLITEREGENFREE_ACTRES_SHARDSAURA_ELECPERMA_CURSEQUESTITEM

of Poseidon

Depth 90 / Weight 7.0 lb / Value 555,555 / Damage 20d1

Activates: Earthquake

STRDEXSPEEDBRAND_ACIDSLAY_EVILBRAND_ORDERRES_ACIDRES_FIRERES_SOUNDPERMA_CURSEQUESTITEM

of Hades

Depth 90 / Weight 8.0 lb / Value 555,555 / Armour 4

This simple tunic belongs to Hades, Lord of the Underworld.

Activates: Restoring (every 5 turns)

CONSTEALTHSPEEDSUST_CONFREE_ACTSEE_INVISHOLD_LIFESLOW_DIGESTRES_ACIDRES_ELECRES_COLDRES_FIRERES_POISRES_DARKRES_NETHERRES_NEXUSESP_UNDEADESP_DEMONESP_EVILAURA_COLDPERMA_CURSEQUESTITEM

of Athena

Depth 90 / Weight 5.0 lb / Value 555,555 / Damage 3d8

This is the favored weapon of Athena, the great goddess of War and Wisdom.

Activates: Recharge From Player (every 15 turns)

SUST_INTSUST_WISDEC_MANABLESSEDHOLD_LIFETELEPATHYPERMA_CURSEQUESTITEMDEC_STRDEC_DEXDEC_CONSPELL_POWERINT

of Ares

Depth 90 / Weight 7.5 lb / Value 555,555 / Damage 5d5 / Armour 5

The helm of Ares, the Olympian whose legendary combat prowess exceeds thatof Zeus himself.

Activates: Berserk (every 20 turns)

STRDEXCONSPEEDBLOWSIM_FEARWARNINGREFLECTAGGRAVATEPERMA_CURSEQUESTITEM

of Hermes

Depth 90 / Weight 2.0 lb / Value 555,555 / Armour 2

Activates: Hermes (every 100 turns)

SPEEDDEXSTEALTHFREE_ACTLEVITATIONRES_CHAOSPERMA_CURSEQUESTITEM

of Apollo

Depth 90 / Weight 4.0 lb / Value 555,555 / Damage x0.00

The is the lyre of Apollo, the sun god.

Activates: Clairvoyance (every 20 turns)

STRINTCHRSPEEDSUST_STRSUST_INTSUST_CHRFREE_ACTRES_FEARRES_LITERES_NETHERPERMA_CURSEQUESTITEM

of Artemis

Depth 90 / Weight 3.0 lb / Value 555,555 / Damage x3.50

This is the bow of Artemis, the virgin huntress and twin of Apollo.

Activates: Artemis (every 1000 turns)

STRDEXCHRSTEALTHXTRA_SHOTSSUST_STRSUST_DEXSUST_CHRSEE_INVISRES_BLINDPERMA_CURSEQUESTITEM

of Hephaestus

Depth 90 / Weight 30.0 lb / Value 555,555 / Damage 5d7

Activates: Enchantment (every 200 turns)

STRDEXCONINTWISCHRSPEEDKILL_EVILKILL_DRAGONKILL_UNDEADKILL_DEMONSLAY_HUMANSLAY_ANIMALSLAY_ORCSLAY_TROLLSLAY_GIANTBRAND_ACIDBRAND_COLDBRAND_FIREBRAND_ELECBRAND_VAMPPERMA_CURSEQUESTITEM

of Hera

Depth 90 / Weight 4.0 lb / Value 555,555

Activates: Restore Mana (every 55 turns)

INTWISCHRSPELL_CAPSUST_INTSPEEDSUST_WISSUST_CHRRES_CONFRES_SOUNDDEC_MANAPERMA_CURSEQUESTITEM

of Demeter

Depth 90 / Weight 3.0 lb / Value 555,555

Activates: Demeter (every 100 turns)

WISCONRES_TIMEREGENLITEPERMA_CURSEQUESTITEM

of Aphrodite

Depth 90 / Weight 0.2 lb / Value 555,555

The legendary Apple of Discord, created by Eris in revenge fornot being invited to the wedding of Peleus and Thetis. On thisapple is engraved "For the Fairest," and Athena, Hera, and Aphroditeall laid claim to it. When the Trojan Prince gave the apple toAphrodite, he received Helen of Troy, which sparked the Trojan War.

Activates: Summon Monsters (every 25 turns)

CHRSUST_CHRRES_POISRES_BLINDRES_NEXUSRES_CHAOSRES_DISENFREE_ACTSEE_INVISLEVITATIONTELEPATHYREFLECTAGGRAVATEPERMA_CURSEQUESTITEM

of Destruction

Depth 90 / Weight 0.2 lb / Value 100,000

BRAND_ELECBRAND_FIREBRAND_COLDBRAND_ACIDBRAND_POISVULN_ACIDVULN_ELECVULN_FIREVULN_COLDVULN_POISDEC_CONWEAPONMASTERYQUESTITEM

'Eternal Blade'

Depth 90 / Weight 13.0 lb / Value 120,000 / Damage 7d7

STRCONHIDE_TYPEREGENSPEEDRES_TIMEVORPAL

of Kronos

Depth 90 / Weight 25.0 lb / Value 10,000 / Damage 10d4

An incredibly sharp sickle rumored to have been wieldedby Kronos to castrate his father, Uranus.

QUESTITEMSTRINTWISDEXCONCHRSPEEDRES_FIRERES_SOUNDRES_CHAOSRES_CONFVORPALKILL_GIANTSLAY_EVILKILL_HUMAN

of the Cyberdemon Lord

Depth 90 / Weight 70.0 lb / Value 50,000 / Damage 2d4 / Armour 50

QUESTITEMSTRCONCHRRES_ACIDRES_ELECRES_FIRERES_COLDRES_POISRES_SHARDSRES_CONF

of Mephistopheles

Depth 90 / Weight 0.5 lb / Value 36,000 / Armour 1

QUESTITEMSTRDEXSPEEDHIDE_TYPEFREE_ACTSHOW_MODSDUAL_WIELDING

'Kaumodaki'

Depth 90 / Weight 20.0 lb / Value 50,000 / Damage 5d6

The divine mace of the god Vishnu, preserver of life against chaos.

Activates: Speed Hero (every 225 turns)

WISCONRES_ACIDRES_ELECRES_FIRERES_SOUNDSTUNHOLD_LIFESUST_CONFREE_ACTBRAND_ELECBRAND_ACIDSLAY_DEMONSHOW_MODSRES_CHAOSSEARCHQUESTITEM

'Doomcaller'

Depth 95 / Weight 18.0 lb / Value 250,000 / Damage 7d5

This weapon of wrath, cursed with a violent anger, dives hungrilyinto the flesh of its enemies. It gathers shadows of death into itsowner as they inflict wounds that will never heal.

KILL_DRAGONSLAY_ANIMALSLAY_EVILSLAY_GOODBRAND_COLDSLAY_TROLLSLAY_ORCFREE_ACTRES_ACIDRES_ELECRES_FIRERES_COLDRES_CONFRES_CHAOSSEE_INVISTELEPATHYAGGRAVATESHOW_MODSSLAY_HUMANBRAND_CHAOSVORPALBRAND_FIREBRAND_POISLITEDEC_LIFEDEC_CONBRAND_VAMP

'Bladeturner'

Depth 95 / Weight 60.0 lb / Value 500,000 / Damage 2d4 / Armour 50

A suit of adamant, set with scales of every color, surrounded in a nimbusof perfectly untrammelled yet inextricably intermingled and utterly masteredpowers elemental and ethereal.

Activates: Bladeturner (every 400 turns)

HOLD_LIFEREGENRES_ACIDRES_FIRERES_COLDRES_ELECRES_POISLEVITATIONRES_NETHERRES_NEXUSRES_CHAOSRES_LITERES_DARKRES_SHARDSRES_SOUNDRES_DISENRES_BLINDRES_CONFIGNORE_ACIDIGNORE_ELECIGNORE_FIREIGNORE_COLD

of the Master Tonberry

Depth 99 / Weight 2.5 lb / Value 200,000 / Armour 2

FREE_ACTSUST_STRSUST_CONSTRCONRES_TIMERES_DISENDEC_BLOWSDEC_SPEEDVULN_CONFQUESTITEM

of the Destroyer

Depth 99 / Weight 2.5 lb / Value 200,000 / Armour 5

QUESTITEMDEC_SPEEDREFLECT

of Power (The One Ring)

Depth 100 / Weight 0.2 lb / Value 5,000,000

"One Ring to rule them all, One Ring to find them, One Ring to bringthem all and in the darkness bind them." Made of massive gold, andset with runes in the foul speech of Mordor, Isildur's Bane possessespowers so great that it inevitably twists and masters any earthly beingwho wears it.

Activates: One Ring (every 500 turns)

STRINTWISDEXCONCHRSPEEDHIDE_TYPECURSEDHEAVY_CURSEPERMA_CURSEFIXED_ARTAGGRAVATEDRAIN_EXPSEE_INVISREGENTY_CURSEIM_FIREIM_COLDIM_ELECIM_ACIDSUST_STRSUST_DEXSUST_CONSUST_INTSUST_WISSUST_CHRXTRA_POWERXTRA_H_RESESP_DEMONESP_UNDEADWEAPONMASTERYBRAND_FIREBRAND_COLDBRAND_ELECBRAND_ACID

of Cower (Darnya)

Depth 100 / Weight 0.2 lb

Adorned, showy gilding,set with runes in the strange speech of Heheh, with power so great that itinevitably twists and masters any earthly being who wears it.

Activates: One Ring (every 500 turns)

DEC_STRDEC_INTDEC_WISDEC_DEXDEC_CONDEC_CHRDEC_SPEEDHIDE_TYPECURSEDHEAVY_CURSEPERMA_CURSEAGGRAVATEDRAIN_EXPTY_CURSE

of Chaos

Depth 100 / Weight 2.0 lb / Value 10,000,000

STRINTWISDEXCONCHRINFRAHIDE_TYPERES_ACIDRES_ELECRES_FIRERES_COLDRES_POISRES_LITERES_DARKRES_CONFRES_NEXUSLITESEE_INVISTELEPATHYCURSEDHEAVY_CURSEPERMA_CURSENO_TELEINSTA_ARTQUESTITEMFIXED_ART

'Grond'

Depth 100 / Weight 100.0 lb / Value 500,000 / Damage 9d9

The mighty Hammer of the Underworld, blackened by doomspells of shattering,whose wielder holds the lives of all Morgoth's servants in his hand.

KILL_DRAGONSLAY_ANIMALSLAY_EVILIMPACTSLAY_UNDEADNO_MAGICSLAY_DEMONSLAY_TROLLSLAY_ORCRES_ACIDRES_ELECRES_FIRERES_COLDSEE_INVISTELEPATHYAGGRAVATESHOW_MODSINSTA_ARTSLAY_HUMANRIDINGQUESTITEMFIXED_ART

of Atlas

Depth 100 / Weight 90.0 lb / Value 500,000 / Damage 9d9

IMPACTQUESTITEMSTRSUST_STR

& Platinum Yendorian Express Card~

Depth 127 / Weight 0.2 lb / Value 1,000,000

Activates: Recharge From Device (every 200 turns)

STRINTWISDEXCONCHRSPEEDSTEALTHHIDE_TYPEHOLD_LIFEFREE_ACTSEE_INVISTELEPATHYLEVITATIONSLOW_DIGESTREGENSEARCHLITEWARNINGINSTA_ARTQUESTITEMFULL_NAME

of halfheart

Depth 127 / Weight 5.0 lb / Value 1,000,000 / Damage 8d8

STRDEXSUST_STRSUST_DEXFREE_ACTSEE_INVISBRAND_VAMPKILL_DRAGONSLAY_ANIMALSLAY_EVILBRAND_ELECBRAND_ACIDSLAY_UNDEADSLAY_DEMONSLAY_TROLLSLAY_GIANTSLAY_ORCWARNINGIM_FIRERES_SHARDSRES_FEARTUNNELINFRASEARCHREFLECTLITETELEPATHYREGENREGEN_MANABRAND_FIREBRAND_COLDBRAND_POISSLAY_HUMANHIDE_TYPESHOW_MODSRIDINGQUESTITEMINSTA_ART

of irresponsibility

Depth 127 / Weight 5.0 lb / Value 1,000,000 / Damage x4.00

SPEEDINTWISSUST_INTSUST_WISXTRA_SHOTSDEC_MANARES_DARKRES_LITERES_DISENRES_BLINDIM_COLDSLOW_DIGESTHIDE_TYPESHOW_MODSQUESTITEMINSTA_ART

of the man called sjijn

Depth 127 / Weight 2.5 lb / Value 1,000,000 / Armour 3

Activates: Heal Curing (every 52 turns)

STEALTHCONCHRSUST_CONSUST_CHRIM_ELECRES_ACIDRES_CONFRES_SOUNDRES_NETHERRES_NEXUSRES_CHAOSRES_SHARDSAURA_ELECAURA_COLDRES_POISHOLD_LIFELEVITATIONHIDE_TYPESHOW_MODSQUESTITEMINSTA_ART